SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000034812 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000034812
Domain Number 1 Region: 275-371
Classification Level Classification E-value
Superfamily Immunoglobulin 1.95e-21
Family I set domains 0.018
Further Details:      
 
Domain Number 2 Region: 441-719
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0000000000000706
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.038
Further Details:      
 
Domain Number 3 Region: 28-77
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000943
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Domain Number 4 Region: 197-288
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000122
Family I set domains 0.033
Further Details:      
 
Domain Number 5 Region: 118-195
Classification Level Classification E-value
Superfamily EF-hand 0.000000078
Family Calmodulin-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000034812   Gene: ENSXETG00000015944   Transcript: ENSXETT00000034812
Sequence length 780
Comment pep:known scaffold:JGI_4.2:GL172914.1:1310990:1412803:1 gene:ENSXETG00000015944 transcript:ENSXETT00000034812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKDGFTSPCEKKSCGQGRRCVISLGSKVPQCECLEKCKPRYMPVCGSDGKLYENHCELHR
ASCLHRKKIYIVHSKDCFFKDDTCTMADYNRLKSILLDLQANRKNTQSSPMEDKRSQKRA
LVENLFNYLDMNNDGHLDSFELAQYAKEKELDNGLDCSVEDLLRFDDYNIDGDLTLPEFY
TAFQVIQLTLAQEEMISVTTVTVGLSAVLTCAIHGILRPPIIWKRNGVILNYLDLEDIND
FGEDNSLYITKVTTIHMGNYTCHAYGYEDLYQTHILQVNVPPVIRVYPETQAQEPGVSAS
LKCHAEGIPSPKITWLKNGIDVTPRLSKQLTVLGNGSELHITSVRYEDTGAYTCIAKNEV
GVDEDISSLFIEDSAKKTHLVANILWREEGLSVGNMFYVFSDDGITVIQPRECEVRRQMK
PTERILTSYEEMCDKGQLCQWSSAINVRNKFIYVAQHVQNRILLIDIQMQKVKQSIGVDP
FPAKLFYDKSHDQVWVLSWGDVRRSHPTLQVISDASVGENLHIIRTTFENVDDFFIPPTN
LIINHVRFGFLFNKSRPAIHKIDLETVKHIKTISFTNFSCIPENMAYSHLGGYYFVQCKQ
KGSSSASPQLIIDSVTDAIVGPNSDVSGTPYISSDGHYLVSTDEINGRLKVQTITSQGEM
KLVYDVTTSLYLSDVTFQSSFAEGNQYYVYATSHLQTRVLFVDLSSGRVDLVKNLKDPTA
QKDWQWSTGNRIIKGSGLFGQYIITPAKDSLFIINGRQNLLHCEISGVQRGNTVVWVGEV
Download sequence
Identical sequences F7A7C4
ENSXETP00000034812 ENSXETP00000034812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]