SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000034993 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000034993
Domain Number 1 Region: 5-117
Classification Level Classification E-value
Superfamily POZ domain 2.51e-28
Family BTB/POZ domain 0.0011
Further Details:      
 
Domain Number 2 Region: 490-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.55e-21
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 3 Region: 587-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 546-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-17
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 451-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.49e-16
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000034993   Gene: ENSXETG00000016041   Transcript: ENSXETT00000034993
Sequence length 816
Comment pep:known scaffold:JGI_4.2:GL173077.1:359302:371917:1 gene:ENSXETG00000016041 transcript:ENSXETT00000034993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHAASHSCHLLQQLHEQRIQGLLCDCMLVVKGVCFKAHKNVLAAFSQYFRSLFQNASSQ
KNDIFHLDIKNIGGIGQILDFMYTSRLDLNNDNIQVMLDVAQCLQVQNVLNMCYSFLKLT
NSVGPVTSIPCSGSLPLPSTSPTYSNSVSNEQLSPPLLQDSVTEERHCCLAQTLKESASS
NEVSKVASTPLNAPDKEIQLKHLNQPYKLRDFYSKLFYKENADRAMEQVAGSIIDQAAGA
PNVARAVGVPYVAQAIGAPSVSQAVGAPSIDQAVGAPNVDQAVGAPNVDLAVVPNVEQTV
VPNVCADHNAIETHPWDLNHSEPILGPPDSLTPIPVEPLPAFSHTFVIHQDPEPLPLQFP
EQMQLKKAVHLKKLNILRSQKAAEGSSQPEAVLQSTTEPVYSEGKVLEASDRGYWEKEAG
SGIFEGLHENVEAERVESPLVPAEDGISTNKHCVCNICGKRFKHPSNLELHKRSHTGEKP
FECSICGKHFSQAGNLQTHLRRHSGEKPYICEICGKRFAVSGDVQRHIVIHTGEKPHLCD
ICGRGFSNVSNLKEHEKTHVADKIFTCDECGKSFNMHRKLIKHRIRHTGEKPYNCVTCGK
KFAGSGDLRRHVRSHTGERPYTCDVCNKNFSRSAVLRRHKTTHSKAGENGQNAPEEPSNP
AESPSLGKSQNSDTLTPGISDTLIPEPCHSVENTRTEIESGTTSTYCKLQAVMHQHELSE
AEKLPDDRGKVPKAHVPDASHSYTLAEVAVAVTEENLHSDISLIRPSLVSLDNCAEPVGN
RAAANVYKSPDAPFFSSMTLWGLAMKTLQNESELDQ
Download sequence
Identical sequences F6R8S4
ENSXETP00000034993 8364.ENSXETP00000034993 ENSXETP00000034993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]