SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000035026 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000035026
Domain Number 1 Region: 390-468
Classification Level Classification E-value
Superfamily HMG-box 2.62e-26
Family HMG-box 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000035026   Gene: ENSXETG00000016058   Transcript: ENSXETT00000035026
Sequence length 598
Comment pep:known scaffold:JGI_4.2:GL173637.1:3309:94524:1 gene:ENSXETG00000016058 transcript:ENSXETT00000035026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTPESLAEKERQLSTMITQLISLREQLLAAHDEQKKLAASQIEKQRQQMDLARQQQEQIA
RQQQQLLQQQHKINILQQQIQVQGHMPPLMIPIFPHDQRTLAAAAAAQQGFLFPPGLSYK
PGDNYPMQFIPSTMAAAAASGLSPLQLQQLYAAQLASMQVSPGAKIPTTPQPANAPGTLS
PTGMKSEKRGTSPVAQIKDEAAQPLNLSARPKTADPIKSPTSPTQSFFPVSKTSPVSLSN
KSGIPSPIRGPSLDILSSLNSPALFGDQDTVMKAIQEARKMREQIQREQLLTPHSIDGKL
PINNMGLNNCRSDKMLLDAVTGKICIRSAHTERTHFENLGPQLTGKPNEDGKLGPGVIDL
TRPEDVEGGATVVEARVYRDTRGRSSSEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSN
ISKILGSRWKAMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPKRTCIVDGKKLRIGEY
KQLMRSRRQEMRQFFTVGQQPQIPISTPTGVVYPGAISMATTTPSPQMTSDCSSTSASPE
PSIPVIQSTYGMKLDSGSLGGNDLMNGEDEMEMYDDFEDDPKSDYSSDNEANEAVSAN
Download sequence
Identical sequences F6WA88
ENSXETP00000035030 ENSXETP00000035026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]