SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000035132 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000035132
Domain Number 1 Region: 246-325
Classification Level Classification E-value
Superfamily HMG-box 5.11e-21
Family HMG-box 0.00000798
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000035132   Gene: ENSXETG00000016100   Transcript: ENSXETT00000035132
Sequence length 361
Comment pep:known scaffold:JGI_4.2:GL172813.1:1584694:1655261:-1 gene:ENSXETG00000016100 transcript:ENSXETT00000035132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQMNSAGEDDLGASDEMISFKDEGDQEEKIRESAFTERDLADLKSSLVNESEVSSHPRV
PAMRRTQDAQLVYQDKLTDHMEDGVKHQDEGMYKGSGYPSYPFLMLSDPYLSNGSVSALS
SKVPVVQPSHGVHPLIPYNNESFSHGSHSTHLPADLNQKQGVHRPAQTADIPTFYPLPSG
GVGQISPSVGWFPHPLMLSPSMHTTGIPHPAIIPHSGNKDIDCYERILFRKPHSEPKRER
EPKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQSKYYELA
RKERQLHMQLYPGWSARDNYGKRKRRTREKHQDSSSDPGSPKKCRARFGLNQQTDWCGPC
R
Download sequence
Identical sequences F7BRW9
ENSXETP00000035132 ENSXETP00000035132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]