SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000035184 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000035184
Domain Number 1 Region: 79-157
Classification Level Classification E-value
Superfamily HMG-box 1.57e-21
Family HMG-box 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000035184   Gene: ENSXETG00000016131   Transcript: ENSXETT00000035184
Sequence length 909
Comment pep:known scaffold:JGI_4.2:GL172659.1:1287751:1311457:-1 gene:ENSXETG00000016131 transcript:ENSXETT00000035184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGSVKNKDHSTDGEGAGKRPKRKCLQWHPLLANKILDFLKDTNHEEFQQHITSVVQLLD
GDGLENDETEDNDSSEQRARRPMNAFLLFCKRHRSLVRQEHPRLDNRGATKILADWWAYL
DPNEKQKYTDMAKEYKDAFMKANPGYKWCPTTNKPVKAHSPTVTTRKKLWSFSSETVKDV
PSPKKVPQEDEMPQLNFSIADPTQMGGLSMLLLAGEHALTAHGDHAVSSGICPLTESGFP
QENRDTSLFQFDEISSSTSHSDDPAPAEQSEKSTLFQFAEISSDTSQTQINCVDPAKCCG
NSSLFQLAEQCYSRYHMSLVSNFLVDTRNNYCNKGRKYAIRMNKLHETLLHGPLNECEFV
KLGYCRMCEASEAVKIEISRNVDTDDLVRTPVSIKEEIESSSEDLISRNLNDSSHICEKA
ETNNIKTKKHKAHTLEPIDAELLGLLKREKLKKKKKKNKSDHDAAEKASPKKTCKKRQSS
ESDIESVMYTIEAVAKGDWGIEQIPISPSKKARISTSPKHSIFDLKSAKKKVKSKEKKMQ
KDKPSDSTKELSAPEHIITAPIIDLPSETPESVKSEPPSPTEELPPMCLPEMLKTEDFNS
NKKTETCGSRKSERSCKGALYKTLVSEGMLTSLRANVDRGKRNSGKGCLSDHEGCWNEDS
WAFNQTGTTGSKKLKKTKPKEESTLGLAKLEEEFEKKFNSLPQYSPVTFDRKNASLPRKK
KKTGNGIAEPQKANKGVFQPQKKTFFHKIVNKYKHKKDKQIISDKGICYSITNTMLFIAK
CYISAIAEEKNNRENSPRANNFVSASSIPEFTAIQEPLVGSQKRKARKTKITHLVRSMDG
QTSLKGQISDEKPLSSICEEEGSCRGELLISRETEVEQNNSIAQDMPAVSAFFSLAALAE
VAAMENAHR
Download sequence
Identical sequences F7AFZ8
ENSXETP00000035184 ENSXETP00000035184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]