SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000036492 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000036492
Domain Number 1 Region: 2-185
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.02e-47
Family Calponin-homology domain, CH-domain 0.00000605
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000036492   Gene: ENSXETG00000016732   Transcript: ENSXETT00000036492
Sequence length 297
Comment pep:known scaffold:JGI_4.2:GL173084.1:309076:323531:1 gene:ENSXETG00000016732 transcript:ENSXETT00000036492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGHFNKGPAYGLSAEVKNKLAQKYDVQKEAELREWIEGLTGRTIGKGFMDSLKDGIILC
ELINKLQPGTVRKINEATQNWHKLENIGNFIKGITQYGVKPHDIFEANDLFENTNLTQVQ
YTLLALASVAKTKGATVDIGVKYADRQERKYDLDKLKEGRNIIGLQMGTNKYASQKGMTS
YGTRRHLYDPKLANDQPLDQATISLQMGTNKGASQSGMTAPGTKRQIFDQKLGMEHCDTQ
TISLQMGSNKGASQQGMTVYGLPRQVYDSKYCNAPEYLLAEDQDGQYNNSHQYYNSE
Download sequence
Identical sequences Q5FVW2
8364.ENSXETP00000036492 ENSXETP00000036492 NP_001015796.1.99540 ENSXETP00000036492 gi|58476796|gb|AAH89746| gi|62751948|ref|NP_001015796|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]