SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000039492 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000039492
Domain Number 1 Region: 497-724
Classification Level Classification E-value
Superfamily Kelch motif 1.83e-55
Family Kelch motif 0.00021
Further Details:      
 
Domain Number 2 Region: 224-346
Classification Level Classification E-value
Superfamily POZ domain 3.45e-27
Family BTB/POZ domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000039492   Gene: ENSXETG00000018212   Transcript: ENSXETT00000039492
Sequence length 731
Comment pep:known scaffold:JGI_4.2:GL172816.1:714859:874029:1 gene:ENSXETG00000018212 transcript:ENSXETT00000039492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVLSKTEKQAQGQLLATSVRWGQTPINQSTPWDTEEPPSKQMRKGENPATPPWVTTVSAG
TQASLIAHSYGMTQPPIYSQAANVQAPIIGVTPTLPPHVAPQLPLMTAHYQLQQHQQPAQ
PLSNMVVNLQSQTLYRHSQPMAVPSLTGVSQVPLPGHTAVGNGHMTCPLLPPPPPAQPSA
ALPNSVPDTNGQTAPQVPHSQTSNPDNPNGVQMLRTIGMGKYEFTDPWYPKEMLKELNQQ
RRAKEFTDLKIIVEGKEFEVHQNVLASCSLYFKDLIKRSSRDSAKNGEKLELTMSNINAE
VLELLLEFVYTGSLIIDSANAKILLEAANKFQFHTFCKVCVSFLEKQLTANNCLGILAMA
EAMQCVELYNMAKAYALQNFPEVANQDEILKISKEDFVSYISNDSLNTKAEELVYETVIK
WIKKDPGNRAQHSAELLAVVRLPFIHPSYLLNIVDNEELIKSSEACRDLVNEAKRYHMLP
HARQEMQTPRTRPRLSAGGMEAGVTLADVWCYMSLLDNWNLVSRMIVPRCRHNSVVYDGK
IYTIGGLGVAGNVDHVERYDTIINQWETVAALPKPVHSAAATVCGGKIYVFGGVNEAGRA
AGVLQSYIPQTNTWSFIESPMIDNKYAPAVTLNGFIFILGGAYARATTIYDPEKGNIKAG
PNMNHSRQFCSAVVLDGKIYATGGIVSSEGPALGNMEFYDPKSNTWTLLPNMPCPLFRHG
CVVIKKYIQSG
Download sequence
Identical sequences F7A973
ENSXETP00000039492 ENSXETP00000039492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]