SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000040081 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000040081
Domain Number 1 Region: 469-667
Classification Level Classification E-value
Superfamily Kelch motif 2.88e-61
Family Kelch motif 0.0000114
Further Details:      
 
Domain Number 2 Region: 624-755
Classification Level Classification E-value
Superfamily Kelch motif 7.98e-38
Family Kelch motif 0.0000979
Further Details:      
 
Domain Number 3 Region: 201-317
Classification Level Classification E-value
Superfamily POZ domain 1.46e-29
Family BTB/POZ domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000040081   Gene: ENSXETG00000018507   Transcript: ENSXETT00000040081
Sequence length 757
Comment pep:known scaffold:JGI_4.2:GL173030.1:1072026:1097531:1 gene:ENSXETG00000018507 transcript:ENSXETT00000040081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKVAYLNINIYVFKNFCTSLNMFKNPFAVLDFGYCLQISEPVLNISRMSGSRKDFDVKQI
LKVRWRWFGHQTAPASSMDVHHQEELLDRDQGIISAERKFLHPSELPLPLLGYRRPSNQD
LENLPLCPMASGSELPVASSEFPTGTSDGAPLLGKPDGEDGVNEEDNASESSSCRTSNSN
QTLSSYQTMESCTADESFQSLNHAEQTFKRMENYLRHKQLCDVILIAGDRRIPAHSRLVL
SSVSDYFAAMFTSDVREAKQEEIKMEGVEPNALWALVQYSYTGRLELKEDNIECLLSAAC
LLQLSQVVEACCKFLMKQLHPSNCLGIRSFADAQGCTDLHKVAHNYTMEHFMEVIRNQEF
LLLPAGEIAKLLASDDMNIPSEETILNALLTWVRHDVEQRRKDLSKLLAYIRLPLLAPQF
LADMENNALFRDDIECQKLIMEAMKYHLLPERRPMLQSPRTKPRKSTVGVLFAVGGMDAT
KGATSIEKYDLRTNMWTPVANMNGRRLQFGVAVLEEKLYVVGGRDGLKTLNTVECYNPKT
KTWNVMPPMSTHRHGLGVAVLEGPMYAVGGHDGWSYLNTVERWDPQARQWNFVASMSTPR
STVGVAVLSGKLYAVGGRDGSSCLKSVECFDPHTNKWTLCSQMSKRRGGVGVTTWNGFLY
AIGGHDAPASNLTSRLSDCVERYDPKTDVWTSVASMSISRDAVGVCLLGDKLYGVGGYDG
QSYLNTVEAYDPQTNEWMQVAPLCLGRAGACVVTIKL
Download sequence
Identical sequences F7BXI3
ENSXETP00000040081 ENSXETP00000040081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]