SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000040616 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000040616
Domain Number 1 Region: 165-246
Classification Level Classification E-value
Superfamily HMG-box 1.96e-21
Family HMG-box 0.00000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000040616   Gene: ENSXETG00000018735   Transcript: ENSXETT00000040616
Sequence length 439
Comment pep:known scaffold:JGI_4.2:GL173130.1:404174:424584:1 gene:ENSXETG00000018735 transcript:ENSXETT00000040616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLQADVDPKTGIPRPPHPPDISPYYP
LSPGAVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHSL
HTTGIPHPAIVTPTVKQESSQSDMGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEM
RAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYG
KKKKRKREKQQGEANEHSECYLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKK
KCIRYIQGEGSCVSPPSSDGSLLDSPPSSPAMPDSPASDSKPQTEQTQPLSLSLKPDPLA
RICVPHSPLAQSPARKPSALPVTICQNGAEHAHPHNVLQSSLPYGLSLTQPSTSFLPSHR
SLAGTTQLQPLSLVTKPLE
Download sequence
Identical sequences F7BVL1
ENSXETP00000040616 ENSXETP00000040616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]