SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000040897 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000040897
Domain Number 1 Region: 760-978
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.02e-57
Family Nuclear receptor ligand-binding domain 0.000000389
Further Details:      
 
Domain Number 2 Region: 599-676
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-25
Family Nuclear receptor 0.0000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000040897   Gene: ENSXETG00000026061   Transcript: ENSXETT00000040897
Sequence length 980
Comment pep:known scaffold:JGI_4.2:GL172696.1:3116691:3286730:1 gene:ENSXETG00000026061 transcript:ENSXETT00000040897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKGYKNFQEGGNMERQWGQVPQSMDYSSPNSRQQTPENTYMEIVNVNCDSDPFPQNNT
KADSKAKQDLLPCLQQDGTKPGLLTQELKPELESKELSAAVAESMGLYMDSVRDSDYPYD
QQNQQGTTGSGTIYQSMDQFYKQTTQGTFPADCQTQSLRSSIKADNSMNGKIKSNTVRSP
LSYSEKNLSASSPSVVALPVCSPTGISSTSCSTTFGNFTAHSPVNQITPQSCSPNIDNRC
SISHSPAGTVESPLSSPLSSMRSPISSPPSHGSLKSPVSSPNNITVRPSVSSPGNINTRS
SLSSPSNANNRSTISSPAASSMGSSICSPASSTLGFLPGVTPADGGTASDSITSTETKDK
GAQQIIFPKVEEMGNEIADSTVSPVKFIKPDPDGMFSSSCFGDTGSSEPTFSIPVKQESC
KSTCSSALFKGSQSGNPFPFMDGSYFTFMDDKDYYSLSGILGPPVSSFGDGFEGNGFSNQ
SLNMAIKQETEDSSFYPENNMPSSAIVGVNSCGQSFHYRIGAQGTISLSRPLNRDQSFQN
LSSFPPVSSLVESWKTQSELAQNTLSSRRNDGFPVPGYIPENMSSTTLRSMSTGPSRPSK
VCLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHSYLCAGRNDCIIDKIRRKNCPACRLQ
KCLQAGMNLGGNKSKQLCRLSATLEALLKRIPLKLGLSDEISVTCIVPQQTPNPESAKSS
FLSVTDGIISLGPAWLITQDRPYGVYPLYLFSEPDNWYRELSRSYRVAGKQMVQVVKWAK
VIPGFRNLPLEDQITLIQYSWMCLSSFALSWRSYKHASSQYLYFAPDLIFNEDRMRQSAM
YDLCQGMQQISLEFSRLQLTFEEYTLMKVLLLLSTEVPKDGLKCQAAFEEMRVNYIKELR
KVLLKSPHNSGQSWQRYFQLTKLLDSMQDLVGDLLEFCFYTFRESQALKVEFPAMLVEII
SDQLPKVESGIAKPLYFHRK
Download sequence
Identical sequences F6SI83
ENSXETP00000040897 ENSXETP00000040897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]