SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000040924 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000040924
Domain Number 1 Region: 337-611
Classification Level Classification E-value
Superfamily Kelch motif 5.49e-61
Family Kelch motif 0.00021
Further Details:      
 
Domain Number 2 Region: 40-151
Classification Level Classification E-value
Superfamily POZ domain 3.05e-30
Family BTB/POZ domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000040924   Gene: ENSXETG00000018861   Transcript: ENSXETT00000040924
Sequence length 629
Comment pep:known scaffold:JGI_4.2:GL172741.1:2696533:2703954:-1 gene:ENSXETG00000018861 transcript:ENSXETT00000040924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALGAARSRGLSVSPANACSSGNKMDPTGEIKDELRLYQSTLLQDGLKELLDENKFVDCFL
KAGSKSLPCHRLILAACSPYFREFFLSDESEEKKKNMELDNVEPSTMEAILKYLYSADID
LNDGNVQDIFALASRFQIPSVFTVCVTYLQRRLSPANCLAIFRLGLLLDCPRLAVTARDY
VCDRFMQICNEEDFLQLAPHELIAVISSDGLNVEKEELVFEAIMKWVQTDKENKTKSLSD
VFDCIRFRLMPEKYFTDKVEKHDLIKANPDIVKKVKVIKDAFAGKLPEGSKGKENSGKEG
EDGDVGDEDLLPGYLNDIPRHGMFVKDLMLLVSDTAAVAYDPLENECFLVGLSEQIPRNH
SSIVTKSNQVYVIGGLYVDEENKDQPLHSYFFQLDSIAGDWIGLPPLPSARCLFGLGEAD
DCVYAIAGRDLQSEESLDSVFCYDSKAVAWTEVKKLPIKVYGHSAVSHNSQIYCLGGKTE
DKKCTGRMFVFNPKKGEWKDLPPMRTSRSMFGVTVHKGKIFVVGGVTEEGLTASVEAYDI
ATNKWETLAEFPQERSSINLVSVGGSLYAVGGFAMIQLESKEFAPTEVTDVWKYEDDKKE
WSGMLKELRYAAGATCLDTRLNLFKLTKL
Download sequence
Identical sequences F7AJ67
ENSXETP00000040965 8364.ENSXETP00000040965 ENSXETP00000040924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]