SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000042809 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000042809
Domain Number 1 Region: 10-129
Classification Level Classification E-value
Superfamily POZ domain 2.36e-33
Family BTB/POZ domain 0.00000431
Further Details:      
 
Domain Number 2 Region: 578-634
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 539-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 619-671
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-16
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 5 Region: 511-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000001
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000042809   Gene: ENSXETG00000019779   Transcript: ENSXETT00000042809
Sequence length 702
Comment pep:known scaffold:JGI_4.2:GL172717.1:2172783:2186923:1 gene:ENSXETG00000019779 transcript:ENSXETT00000042809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASQTLTDRCIQFTRHANDVLLNLNRLRSRDILTDVIIVVEGEHFRAHKTVLMACSGLFY
AIFTDQMKCNSNIINLNTDVSAEGFRVLLDFMYTSRLNLRDSSIMAVMSTALYLQMEHVV
DTCQRFLKSSEDIVAMKPPRDEFLPGRAMLPPDVMAYRNCEMSENTIPFRSGTMCDGRSY
LSSLYSSSTSSYPLYGHMPVPGFLFPEDEVKDMQMSEMQKASRNQKESVLPGENSRTLLG
DYRKVMSDMSFNMCHSNNYSQKDVAMEEPRSEAHYNMVIGSRSAGPSFRSSPFFTCEKTT
KEEERTSSEDEISQHFKPTNSPANRKGLVSPQSPQKSDCQPNSPTESSSSKNARISQGSS
SPVSKNSTDPKACNWKKYMMLSSLKQRDKESCTKQSEIDNLSPNSYTSLSSYQHPVKSEN
ADDQASPKINGSTEDPLIPQASKLNNLVNRSLEGSPQSSEGHSPLYVHASKFNLFSSQSP
PELCPHTPGSNFGEEITETQSEYSDSSCENGTFFCNECDSRFSEEGSLKRHMLQVHSDKP
YKCDRCQASFRYKGNLASHKTVHTGEKPYRCSICGAQFNRPANLKTHTRIHSGEKPYKCE
TCGARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHCEKCNL
HFRHKSQLRLHLRQKHGAITNTKVQYRVSSSSDLPSDNPKSC
Download sequence
Identical sequences F6QPC5
ENSXETP00000042809 ENSXETP00000042809 8364.ENSXETP00000042809 XP_012818099.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]