SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000043607 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000043607
Domain Number 1 Region: 354-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-22
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 2 Region: 436-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 492-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-18
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 4 Region: 315-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-18
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 549-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.19e-18
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 6 Region: 99-128
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000314
Family KRAB domain (Kruppel-associated box) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000043607   Gene: ENSXETG00000020205   Transcript: ENSXETT00000043607
Sequence length 607
Comment pep:known scaffold:JGI_4.2:GL173618.1:37956:53542:-1 gene:ENSXETG00000020205 transcript:ENSXETT00000043607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLVLAEVSDLEWRRGREKNIFKNKNGATKEILDLTIEILSLLTGEDYILIKKELSNGEDY
SDHNTSDSTEETNSLQNLWENGQKVLELANKIVCLLTGEVPVRCEDVAIYLSQEEWEYLA
GHRELYTEHKGRGCLSLYPHRCTEEERRAGRDFKAFIMGFHCKAIHLAFLGVEQADLVHT
EEVIPTDAIKTEAPSEDYPDTAPTCENETQIPTERLQGAAIGNDFHSSLEAHLPDSPSRH
RKNQTVSVTKEHTALRCSAAPIAITVSAVSPSSSYTKLCTKISAAKIGKSPTQQSERQGK
GGKGVTQLVTNNGVKPFTCSECGKSFTKRSNLTMHLKIHSGERPFSCSECGKCFTQSSKL
LIHQGTHTEEKPFACSECGKSFSQMGYLLTHKRIHTGEKPFSCPQCGKLFTRKSTLLKHQ
RIHTGSFPCSYCGKCFSQKSNLMSHQRIHTREKPFACASCDKCFTDKSALIKHERVHTGE
RPFICTHCGKGFTQITHLTTHLRSHTGEKPFACPDCGRCFAGKPALVKHRRLHDTGEKPF
QCPVCSKCFSDKSVLIRHHKSHTGQRPFTCSYCEKCFSHRAGLLEHLSLHAGDRPYVCPE
CGKCFKY
Download sequence
Identical sequences F6VSW1
ENSXETP00000043607 ENSXETP00000043607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]