SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000045614 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000045614
Domain Number 1 Region: 323-404
Classification Level Classification E-value
Superfamily HMG-box 7.85e-21
Family HMG-box 0.00000705
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000045614   Gene: ENSXETG00000019015   Transcript: ENSXETT00000045614
Sequence length 553
Comment pep:known scaffold:JGI_4.2:GL172666.1:2715735:2750080:-1 gene:ENSXETG00000019015 transcript:ENSXETT00000045614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQLNSGGGDELGANDELIRFKDEGEQEEKSPGEGSAEGDLADVKSSLVNESENHSSDSD
SEVERRPPPRETFEKPRDYLSEAFRRQQDAAFFKGPPYAGYPFLMIPDLGGHYLPNGALS
PSARTYLQMKWPLLDSPSTAGLKDARSPSPAHLSNKVPVVQHPHHMHPLTPLITYSNEHF
SPGTPPGHLSPEIDPKTGIPRPPHPSELSPYYPLSPGAVGQIPHPLGWLVPQQGQPMYSI
PPGGFRHPYPALAMNASMSSLVSSRFSPHMVPPPHHGLHTSGIPHPAIVSPIVKQEPSSG
NISPNLITKPSVVVKKEEEKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGR
RWHSLSREEQAKYYELARKERQLHSQLYPTWSARDNYGKRKKRKRDKQSPEMEITKTKKM
CVQHLPADKSCDSPASSHGSMLDSPATPSAALASPAAPAATHSEQAQPLSLTTKPEARAQ
LSLSHSAAFLASKSPPSSSLSGSLSSPVGSPLLSRPIPLTSSILSPPCVFPSALQALPLL
QAQPLSLVTKSSD
Download sequence
Identical sequences Q6GL68
ENSXETP00000045614 8364.ENSXETP00000045614 NP_001005640.1.99540 ENSXETP00000045614 gi|49257762|gb|AAH74638| gi|54020789|ref|NP_001005640| gi|82183781|sp|Q6GL68| gi|89272527|gb|CAJ83911|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]