SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000045670 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000045670
Domain Number 1 Region: 213-452
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.16e-70
Family Nuclear receptor ligand-binding domain 0.00000000116
Further Details:      
 
Domain Number 2 Region: 15-100
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.85e-32
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000045670   Gene: ENSXETG00000021123   Transcript: ENSXETT00000045670
Sequence length 464
Comment pep:known scaffold:JGI_4.2:GL172931.1:794066:813903:-1 gene:ENSXETG00000021123 transcript:ENSXETT00000045670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INSLLYSHSTAQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNC
LIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQRDHQQPP
GEAEPLNPAGYGLTPNGLTELRDDLGGYMEEESKNDSTVNSFYLDIQPSPDQSGLDVNGI
KPEPLCDYTPASSFFPYCSFTNGETSPTISMAELEHLAQNISKSHMETCQYLREELQQLM
WQTFLQEEIDNYQSKQREVMWQLCAVKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAG
SLEVVFIRMCRAFDSQNNTVYFDGKYAGIEVFKALGCEDFISFVFEFGKSLCSLHLTEDE
IALFSAFVLMSGDRSWLQEKMKIEKLQQKIQLTLQHVLQKNHREDGILTKLICKVSTLRA
LCGRHAEKLMAFKAIYPDIVRHHFPPLYKELFTSEYEPAMQLEG
Download sequence
Identical sequences F6UUA0
ENSXETP00000045670 ENSXETP00000045670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]