SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000046327 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000046327
Domain Number 1 Region: 585-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000004
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 669-721
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000969
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 3 Region: 312-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000581
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 446-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000213
Family Classic zinc finger, C2H2 0.074
Further Details:      
 
Domain Number 5 Region: 541-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000265
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 6 Region: 629-673
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000896
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000046327
Domain Number - Region: 49-78
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00614
Family C2HC finger 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000046327   Gene: ENSXETG00000021426   Transcript: ENSXETT00000046327
Sequence length 844
Comment pep:known scaffold:JGI_4.2:GL172674.1:2554036:2566391:-1 gene:ENSXETG00000021426 transcript:ENSXETT00000046327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQAIFEAFEGMDNQTVLAVQSLLDGQGGVSDHSAQTVTNSAPIQSMDDEDVFLCGKCKK
QFNSLPAFVIHKREQCHGSAPSLSSVTMGAHSAYTPPVSSVQQSQVNNRQISTYIAVPPS
PLIQTLVQGNVLVNDEVLLSAMSAFTSLDQSMPPVPAPVQTNPSMHSAGTYLHAPSLPLR
PSHPPPSAPGHSPLGAHVQANSSSCSTVVQVYSSPISMPGNPAMELHGMNMAPYTQIEVQ
SQCVESSVYNTPPVYSPGKQELKSKTPSSCSPCTGLGGSSMGSLEPSLPNKARRSKADSG
IRNGSVPPRPKCVYVSICSFAFIRAVELESLFCSHTGEKPFQCIVCGRAFAQKSNVKKHM
QTHKVWPREQNTTKSLAPVSVQVLPLNPSQAQEKVAENGANSQPPTEEAPAEGMEVAPGS
MGEGPDAKHVVLVDSSYHCQFCPSKFDSYFQLKSHMTQHKQEQVYKCVVKGCGHTSQKLD
HFLEHIKTHQEELTYRCHLCNKDCASLYEMGVHQYSHCMLPQITPKKDQAVYKCLKCMNK
YSTPEALEQHLQTATHSYPCPHCPKVFPCERYLRRHLPTHGGGGRYKCPICKKLFRREHY
LKLHSHIHSGEKPFRCALCDSAFNRKDKLKRHMLIHVPYKKYKCPFSSHTGCNKEFNRPD
KLKAHMLSHSGIKTHKCQYCSKSFSRRAHMVEHQRSHTGNYRYSCPNCGKGFTRQKYMKE
HKCRLHSDGDKDQQGLRHIQVRKVQRKRGQGVDSGTEDEGTFTNLKNVTEPIDSSGDQIE
ESFPTAEAQLSIVVGSQEHSRDGLGVPPGVNTMTSTTVTLAELQSGADSSCAMLAVPIYI
QNPE
Download sequence
Identical sequences F6TRB4
ENSXETP00000046327 ENSXETP00000046327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]