SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000047038 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000047038
Domain Number 1 Region: 41-513
Classification Level Classification E-value
Superfamily Sema domain 3.4e-141
Family Sema domain 0.0000000000384
Further Details:      
 
Domain Number 2 Region: 1077-1339
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.52e-79
Family Protein kinases, catalytic subunit 0.000000000311
Further Details:      
 
Domain Number 3 Region: 651-739
Classification Level Classification E-value
Superfamily E set domains 6.24e-16
Family E-set domains of sugar-utilizing enzymes 0.084
Further Details:      
 
Domain Number 4 Region: 557-654
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000369
Family Other IPT/TIG domains 0.063
Further Details:      
 
Domain Number 5 Region: 515-560
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000824
Family Plexin repeat 0.0005
Further Details:      
 
Domain Number 6 Region: 737-825
Classification Level Classification E-value
Superfamily E set domains 0.0000000091
Family E-set domains of sugar-utilizing enzymes 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000047038   Gene: ENSXETG00000021752   Transcript: ENSXETT00000047038
Sequence length 1388
Comment pep:known scaffold:JGI_4.2:GL172757.1:658755:715602:1 gene:ENSXETG00000021752 transcript:ENSXETT00000047038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VHAKMLVAVPVAFVFLSLLLKCMGQCEEAAKMAEMDLNIKHNLQSFTTDTPIQNIIMFKG
YIYVGAVNKIYVLNENLTKVSEYKTGPLLVHSHCLPCKNCTDNFLSPNGTWKDNVNMALF
VEDFYDDQLISCGNIRRGECQRHTLHSDKPWDIASNVHCLYSSQMIEDKDNCPDCIVSTT
GSKILVTVRDRFVKFFVGSTLTGQPSTIHSVSVRRLKETQDGFEYLTDQSYIDVLPQLRD
IYPIKYIYTFESNNFVYFLTVQRESIDSQAYHTRIVRVCSSDSELRSYIEMPLECIFTEK
RRKRSTAGAVFNILQAAYLGRAGEDLAEEMGVKPDDDILYAVFAQSKLDSSEANNRSAVC
AVSVKTINEFFNNAADKQNTKCLEHFYEKDNRLCINNKKFLRNASYCSTPIDEYRVEVTT
VLRRLDLFMDQFRNVLLTSISVFTQGRLTIANLGTSEGRFMQVVISRTGQPKPHVNFLLE
PRPVSPEVVINPASEESGYTLVNTGMQLTKVPLVVLTCGHLKSCSHCLSSPSVNCGWCKN
RCTRKQECLNEEWIQETCPPAVYEVFPSSAPLEGGTQLTICGSDFVLSKNNNFDLKNTMV
IIGKKRCKIEGKFSNQNKLVCRIDSSASSVFNISSSVSNGKQVVNFTTFSYVNPIITSIM
PSHGPKAGRTLITMKGQYLNSGKEQKVIIGKEMCKIKSVSSAAIECYTPVQRTTGTYLVA
LKIDNADRESSTRFTYMEDPSVSNIKPVKSFLSGGSSITAYGRNLNAVASPQMVIRLSKP
ELSYNMSCIHRSTSELICCSTPSLKELNLEPPITTQVFFILDGVISNYFELSYVNNPIFE
TFEKPVVFPIGNKNILEIKGDHIDSEAVRGEVLKVGNKSCEIIQSKSDSVSCSVPTDLFK
SNSELKIEFLQGVSSIIIGKVMVTQDQNFTGIITGVVSCVVLLLIIFGVLIWMKKRKQLK
DLGGDMVLYDGRVHTPHLDRLVSARSISPTTEMVSSESVDYRSTVQEDPFPNSSQNGSCR
PAQYAHRDLSPILSSGDSDIASPLLHSYVHIDISALSTDLMKEVEHMVIRVDRLIVHFNK
VIGRGHFGCVYHGTLLDIDGKNVHCAVKSLNRITDIEEVSQFLKEGIIMKDFSHPNVLSL
LGICLPNEGSPLVVLPFMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMEYLASKKFVH
RDLAARNCMLDEHFTVKVADFGLARDVYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTT
KSDVWSFGILLWELMTRGAPPYPDVNSFDITIYLLQGRRLLQPEYCPDPLFEVMLKCWHP
RPELRPTFSELVSRISSIFSTFIGEHYVLFNATYVNIKCAAPYPSLLSPEDNTECSIDTN
SSLFYVTA
Download sequence
Identical sequences F6VHT9
ENSXETP00000047038 ENSXETP00000047038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]