SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000047237 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000047237
Domain Number 1 Region: 49-105
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000089
Family HLH, helix-loop-helix DNA-binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 111-163
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000915
Family Hairy Orange domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000047237   Gene: ENSXETG00000021844   Transcript: ENSXETT00000047237
Sequence length 319
Comment pep:known scaffold:JGI_4.2:GL172817.1:1250051:1276829:1 gene:ENSXETG00000021844 transcript:ENSXETT00000047237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPCDDTSSDSDIDETIDVGSENNYSGHSSGSLIRSNSPTTTSQIMARKKRRGIIEKRR
RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMD
FMSIGFRECLTEVARYLGSVEGLDSSDPLRVRLVSHLSSCASQREAVAMTSTVAPHQHSL
HPHHWAAAFHHLPAALLQQNGLSSSDNMTCRLSTATELPSQHGSALLTATFAHADAALRV
PAAGSVPPGVPPLSTSLLSLSATVHAAAAAAAQSFPLSFAGAFPVLPASPLSLTSSPRQA
GGNVSSKPYRPWGTEVGAF
Download sequence
Identical sequences F6UN71
ENSXETP00000047237 ENSXETP00000047237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]