SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000050690 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000050690
Domain Number 1 Region: 41-114
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000811
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 124-171
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000106
Family Hairy Orange domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000050690   Gene: ENSXETG00000023482   Transcript: ENSXETT00000050690
Sequence length 427
Comment pep:known scaffold:JGI_4.2:GL173303.1:211614:215397:-1 gene:ENSXETG00000023482 transcript:ENSXETT00000050690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGIPSLQDRQLEPRDFLGRATPSTLRHRATPSTLRQFSRETYKLPHRLIEKKRRDRIN
ECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKGLTSLTEQQHQKIMALQNGEHALK
SPIQTDLDAFHSGFQTCAKEVLQYLSRFESWTSRDQRCTQLLNHLHTVSSQILSSSQLLL
QSVPGGKGSSASPGRGGQKAENQTNCVPVIQRTHNLELNENDTDTDSGYGGEGEKAEGRS
DGQSSSGVKSQGGNSLTIKQEPMEEPSPKRFKPEFPGRGVTGPNAEPAVRPDAALLNSLM
AFGGAPFGQQAPFCLPFYFISPSAAAAAAYMPFLDKGSLEKYLYPAAAAAAAATPIPLLY
PGIPGQASGTFPCLSSVLSPEKMAACSSALLPELPSPPFQTGPAMDRGLTEELREPLEGL
LPPSKEN
Download sequence
Identical sequences F7AS23
ENSXETP00000050690 8364.ENSXETP00000050690 ENSXETP00000050690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]