SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000051399 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000051399
Domain Number 1 Region: 218-232,376-625
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.37e-65
Family Nuclear receptor ligand-binding domain 0.0000594
Further Details:      
 
Domain Number 2 Region: 149-231
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.16e-30
Family Nuclear receptor 0.0000854
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000051399
Domain Number - Region: 62-142
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00934
Family Ricin B-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000051399   Gene: ENSXETG00000023840   Transcript: ENSXETT00000051399
Sequence length 637
Comment pep:known scaffold:JGI_4.2:GL172780.1:2194842:2210505:-1 gene:ENSXETG00000023840 transcript:ENSXETT00000051399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASIEEIAHQIIEQQMGEISRSQPEISQTALMDGTTQRIQLVPSESSVSVPQRIQIVTDP
QTGQKIQIVTALDQSGASKQFILTNNDGSLPSKVILTRQDSSQGKVYLTTPDAAGVNQLF
ISTPDVPAQHIQILSDTQCLDQNLNKQLVELCVVCGDKASGRHYGAVTCEGCKGFFKRSI
RKNLVYTCRGSKDCVINKHYRNRCQYCRLQRCIALGMKQDSVQCERKPIEVSREKSSNCA
ASTEKIYIRKDLRSPLAATTTFVTENKTSSRTTSLLDSGMLVNIQQSGVKNESILITPNK
VDACQGDLSTLANVVTSLANLNKSKELPQTNTELSIIESLSNGDSSLSELAQDDQSNSEV
TRAFDTLAKALNQSENSAQGSSECVGSNSNLTDANVEIEGPLLSDAHIAFRLTMPSPMPE
YLNVHYICESASRLLFLSMHWARSIPSFQSLGQENSISLVKACWNELFSLGLAQCCQVMN
VETILAAFVNHLHNSMQHDKLSADKVKLVMDHIFKLQEFCNSMVKLSVDGYEYAYLKAIA
LFSPDHPGLENVSHIEKLQEKAYMEFQDYVTKTYPEDTYRLSRLLLRLPALRLLNAAITE
ELFFAGLIGNVQIDSIIPYILRMETSDYNSQIIGLTV
Download sequence
Identical sequences G1K3L2
ENSXETP00000051399 ENSXETP00000051399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]