SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000052774 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000052774
Domain Number 1 Region: 169-413
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-71
Family Nuclear receptor ligand-binding domain 0.000000000726
Further Details:      
 
Domain Number 2 Region: 59-149
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.97e-28
Family Nuclear receptor 0.00000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000052774   Gene: ENSXETG00000024399   Transcript: ENSXETT00000052774
Sequence length 418
Comment pep:known scaffold:JGI_4.2:GL173218.1:438851:555978:-1 gene:ENSXETG00000024399 transcript:ENSXETT00000052774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQNLSGLDCLSEPDEKRWPDGKRKRKNSQCMGKSGMSGDSLVSLPSAGYIPSYLDKDEP
CVVCSDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYDGCCIIDKITRNQCQLCRF
KKCIAVGMAMDLVLDDTKRVAKRKLIEENRERRRKEEMIKTLQQRPEPSKEEWELIRIVT
EAHRSTNAQGSHWKQRRKFLPEDIGQSPMASMPDGDKVDLEAFSEFTKIITPAITRVVDF
AKKLPMFSELPCEDQIILLKGCCMEIMSLRAAVRYDPDSETLTLSGEMAVKREQLKNGGL
GVVSDAIFDLGRSLAAFNLDDTEVALLQAVLLMSSDRTGLMCTDKIEKCQETYLLAFEHY
INHRKHNIPHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFEDQEV
Download sequence
Identical sequences B3GR07
XP_012807993.1.99540 ENSXETP00000052774 8364.ENSXETP00000052774 gi|189514197|gb|ACE07028| ENSXETP00000052774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]