SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000053697 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000053697
Domain Number 1 Region: 54-133
Classification Level Classification E-value
Superfamily HMG-box 9.16e-28
Family HMG-box 0.0000453
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000053697   Gene: ENSXETG00000025005   Transcript: ENSXETT00000053697
Sequence length 383
Comment pep:known scaffold:JGI_4.2:GL175899.1:700:3021:1 gene:ENSXETG00000025005 transcript:ENSXETT00000053697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPDGGYASDDQNQGKCSVPIMMTGLGQCQWAEPMNSLGEGKLKSDAGSANSRGKAEAR
IRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQ
HMQDHPNYKYRPRRRKQVKRMKRADTGFMHMAEPPESAVLGTDGRMCLESFSLGYHEQTY
PHSQLPQGSHYREPQAMAPHYDGYSLPTPESSPLDLAEADPVFFTSPPQDECQMMPYSYN
ASYTHQQNSGASMLVRQMPQAEQMGQGSPVQGMMGCQSSPQMYYGQMYLPGSARHHQLPQ
AGQNSPPPEAQQMGRADHIQQVDMLAEVDRTEFEQYLSYVAKSDLGMHYHGQESVVPTAD
NGPISSVLSDASTAVYYCNYPSA
Download sequence
Identical sequences Q8AWH3
ENSXETP00000053697 8364.ENSXETP00000053697 gi|26224738|gb|AAN76329| gi|45361701|ref|NP_989425| gi|49257720|gb|AAH74527| gi|50253590|gb|AAT71996| gi|82177300|sp|Q8AWH3| gi|89271305|gb|CAJ82986| ENSXETP00000053697 NP_989425.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]