SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000055635 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000055635
Domain Number 1 Region: 950-1159
Classification Level Classification E-value
Superfamily SET domain 1.7e-75
Family Histone lysine methyltransferases 0.0016
Further Details:      
 
Domain Number 2 Region: 842-940
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 8.42e-27
Family PWWP domain 0.0000258
Further Details:      
 
Domain Number 3 Region: 210-325
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.29e-25
Family PWWP domain 0.0029
Further Details:      
 
Domain Number 4 Region: 788-852
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000664
Family PHD domain 0.0037
Further Details:      
 
Domain Number 5 Region: 1177-1249
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000244
Family PHD domain 0.0041
Further Details:      
 
Domain Number 6 Region: 413-485
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000128
Family HMG-box 0.0023
Further Details:      
 
Domain Number 7 Region: 614-677
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000354
Family PHD domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000055635
Domain Number - Region: 681-735
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00532
Family PHD domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000055635   Gene: ENSXETG00000026376   Transcript: ENSXETT00000055635
Sequence length 1293
Comment pep:known scaffold:JGI_4.2:GL172873.1:328961:364578:-1 gene:ENSXETG00000026376 transcript:ENSXETT00000055635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQFKIKLNIITPKTVICITMKQVPHILGSPAVKPSNPEVSRECSVLLGRAQISASLQEGV
IQKLNGHDSLPFIPTEKLKDLTSRVFNGESGAQEAKVRFEAQEVQGIETPPSTTPTKNGS
PEIKLKITKTYMNGKPLFESSICGDRGEEEPQPEQKKSKRGRKRKIITSEANEKSSSEMP
SHSESSKPLLQKPVSESEFLEHKNKEDFSLKYSVGDVVWSKVSGYPWWPCMVTSDPVLYS
HTKVKGQKKNVRQYHVQFFGNAPERAWISEKSMVPFKGENEYDHLCQESAKQAPTKAEKT
KLLKPITGKIRAQWDIGIEQAKEGILMTPEERKEKFTFIYIKDRPQLNPRVASEVGVPVE
SSEKSTESPQKEGSSSYKRRRVSRTPAASKEVDPADKTTTAKGPENSSDPKGMTSPASKK
RSGAYTPRSRKGDAVNQFLVFCQKHKDEVINEHPDASDEEIEELLESQWNMLSNKQKARY
NTKFAILTSPKSEEDSGSLHGHKRNHLKTTHNQTEDSEIQESPRKRLRMHNRKQRETCKP
PKARASAPVKNSPAMFSLSDACKPLKKRNRSSTLGSVALPVSKSSSPASLTENEVSDSQG
DERSESPSESADESQAEISMLHRKSERGAMKKELVCQVCEKVGDLMLCEGVCCSAFHLSC
IGLSTRPAGKYLCKECTSGARSCFLCKESNRDVKRCIVPHCGKFYHESCLRKYPLAVFES
RGFRCPLHRCATCYFSNPSNPRASKGKMVRCVRCPLAYHGAESCIVAGCTALTSTSIICS
SHFAANKAKSHHAHINVSWCFVCSNGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRL
GKKPRFNDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHAIGEFPVFFFGSKDYYWTHQA
RVFPYMEGDRGSKHHGGKSIGKVFKNALQEAETRFCEIMRQREAKVTQENEKKPPPYKHI
KVNKPYGKVQVYTADISEIPKCNCKPSSEKPCGFDSECLNRMLMYECHPQVCPAGDRCQN
QCFNKRQYPETKIIKTEGKGWGLIATRDIKKGEFVNEYIGELIDEEECMYRIRHAQENDI
THFYMLTIDKDRIIDAGPKGNFSRFMNHSCQPNCETQKWSVNGDTRVGLFAVRDIPAGEE
LTFNYNLDCLGNEKTICRCGAPNCSGFLGDRPKNNTASSHEEKVKKPKKKQKKRRTKTDG
KKQSEDYCFRCNDGGELVLCDRKFCTKAYHLSCLSLTKRPFGKWECPWHHCDVCGKASVS
CCSLCPNSFCKGHYDDSQFTRTAEGQLCCPEHD
Download sequence
Identical sequences F6V1Z3
ENSXETP00000005100 ENSXETP00000055635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]