SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000055937 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000055937
Domain Number 1 Region: 114-163
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000115
Family Hairy Orange domain 0.0023
Further Details:      
 
Domain Number 2 Region: 52-111
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000209
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000055937   Gene: ENSXETG00000001769   Transcript: ENSXETT00000055937
Sequence length 295
Comment pep:known scaffold:JGI_4.2:GL172843.1:1143438:1145266:-1 gene:ENSXETG00000001769 transcript:ENSXETT00000055937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPADSMEKPTASPIAGAPASSAQTPDKPKSASEHRKVNVNEYARLMAILQSSKPIMEKRR
RARINESLGQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRVQMTAALTADPSV
LGKYRAGFNECMNEVTRFLSTCEGVNTEVRTRLLGHLSSCLGQIVAMNYQQPPSSQQPLH
VQLPSSTPAPVPMPCKVNPAEAISPKVFQGGFQLVPATDGQFAFLIPNPAYTTSPGPVIP
LYANTNVTSPGGPQSQSPVQGLTTFGHKMPHMAQAVSPLGGSTGADSAESVWRPW
Download sequence
Identical sequences F6SLY1
ENSXETP00000055937 ENSXETP00000055937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]