SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000057398 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000057398
Domain Number 1 Region: 23-393
Classification Level Classification E-value
Superfamily L domain-like 4.99e-62
Family Ngr ectodomain-like 0.0025
Further Details:      
 
Domain Number 2 Region: 574-649
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000401
Family Fibronectin type III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000057398   Gene: ENSXETG00000012043   Transcript: ENSXETT00000057398
Sequence length 785
Comment pep:known scaffold:JGI_4.2:GL172692.1:442028:444646:1 gene:ENSXETG00000012043 transcript:ENSXETT00000057398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKAALVEVLVLLTCTLARSVEPKCLEPCDCQHQQHVLCSNRGLLSVPKSSHMLSSSATK
TYSLGGNFIANISALDFVQFPQLQRLDLQYNRIGSIHPKAFEKLTELEELYLGNNLLATL
APGALAPLRKLKVLNVNGNRLHNISRVSFSNLAALIKLRLDGNDIQNLQGSPFSALSNLL
YLHLENNKITNISKNAFTGLGKLRLLSLSGNPQSFLRQPTFLPLRALSTLTMAGNQLQQL
GPSLFNGLQRLSRLVLSSNQISVIQTKTFLGLDLLQELHLDGNKLVQLPEGVLVPLHNLE
VLNLSRNAISHLHPETFKGLMRLRVLDLQHNMLRYLSGQTFAGNPVLYRLQLDGNRWSCD
CQLLDLKHWILGTLHSRSRMLTVFVQCFEPQKVAGKYLDYLEDAYLWDVGGCRISTTPAV
VTGADNLRVQPKTEEKSLQLPTPPSEVSPALETLALRQQALVTKWPSSTNKDGTAKNRGL
ETSRKGKGKSVKNSAEHSRKLHLVAQPVHPTQSKVKQASVLIPASSNLPPNSESMHSEKP
VRLDTPSVVPDLEDVAPFPSLLSDPCEFNKLYLVNLSVESVGSSTARVRWQTLSAHTRGP
VLCRVLYERFGQTGRFQRFVYPRGRVESLTLQELTGETPYLVCVESIIGGRACPMAPRDH
CVGLVTLPSEDDRPLLNYQVLALALLAVNALLLLLGLVAWVSRLAHRKWGRRRAPVHVRQ
MYSTRRPYRSVGTGVSTDFSGFQSHRPRTTVCALGEADLIEFPGCDRFREGGNIHREDLL
QRFTD
Download sequence
Identical sequences F6VML5
ENSXETP00000057398 ENSXETP00000057398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]