SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000058732 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000058732
Domain Number 1 Region: 766-1079
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.78e-51
Family Ankyrin repeat 0.0000354
Further Details:      
 
Domain Number 2 Region: 455-714
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.26e-48
Family Ankyrin repeat 0.00034
Further Details:      
 
Domain Number 3 Region: 221-411,442-526
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.99e-41
Family Ankyrin repeat 0.0003
Further Details:      
 
Domain Number 4 Region: 47-157
Classification Level Classification E-value
Superfamily POZ domain 5.57e-22
Family BTB/POZ domain 0.0056
Further Details:      
 
Domain Number 5 Region: 1105-1164
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.63e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000058732   Gene: ENSXETG00000030210   Transcript: ENSXETT00000065804
Sequence length 1170
Comment pep:known scaffold:JGI_4.2:GL172659.1:3413150:3462940:-1 gene:ENSXETG00000030210 transcript:ENSXETT00000065804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEEVGKLQKHLALLRQEYVKLQQKLAETEKKCTLLAAQANKEASSDSFISRLLSIVAQ
LFQQEQYSDLMIKVGDKHINAHKFVLAARSEVWSPANLASTKELDLSDSNPEVTMAMLRW
VYTDELDLREDDIFLTELMKLANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNAN
ALLNYCAEIIASHWDDLRKEDFSSMSAQLLYKMIKSKTQFPLHKAIKLEREDVVFLYLIE
MDSQLPGKLNELDQNGDLSLDLALSRRLESIATTLVNNKADVDMMDKKGCSLLHKAICRD
DKFAANFLIKNGALVNAATVGEQQTPLHLVASCTVKDRSVEVMSDIAQIAEALLKAGANP
NMQDSKGRQSFPLHAAVLARNEYVFNQLLLCKQLDLELKDHEGSTALWLAVQYITVSSDQ
SVNPFDDVPVVNGTSFDENSFAARLIKQGSNTDAPDTVTGNCLLQRAAAAGNEAASLFLA
THGAKVNHKNKWGESPLHTACRHGLSNLTAELLQQGANPNIQTQEPITSPRGPPANSLAD
STYLQTPLHMAIAYNHPDVVSVILEQKANALHATNNLQIIPDFSLKDSREQTVLGLALWT
GMHTIAAQLLGSGASINDTMSDGQTLLHMAIQRQDSKSALFLLEHQADINVRTRDGETAL
QLAIKNQLPLVVDAICTRGADMSVTDEQGNPPLWLALENEQEDIASTLVRHGCDATFWGP
GPSGCQQTLLHRAIDENKEQIACFIIRSGCDVNSTRKPGPNGEGEEEARDGQTPLHLAAS
WGLEEVVQCLLEFGANVNTQDAEGRTPIHVAISNQHRVIIQLLISHPDIRLNVRDRQGMT
PFACAMTFKNNKAAEAILKREPGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVQANVNS
RVQDASKLTPLHLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDLPVICSVLL
ENGVDFSAADENGNNALHLAIMHGRLNNIRCLLTECNVDAEALNLRGQSPMHILGQYGKE
NAAAISELFLECMPQYPLDKPDAEGNTVLLLAYMKGNANLCRAIVKAGARLGVNNSQGIN
IFNYQVATKQLLFRLLDMLSQEPPWCDGSNCYECAAKFGVTTRKHHCRHCGRLLCSKCST
KEIPIIKFDLNKPVRVCDICFDVLTLGGVS
Download sequence
Identical sequences F6S4R8
ENSXETP00000058732 ENSXETP00000058732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]