SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000059170 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000059170
Domain Number 1 Region: 28-91
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000118
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000059170   Gene: ENSXETG00000030789   Transcript: ENSXETT00000063066
Sequence length 259
Comment pep:known scaffold:JGI_4.2:GL173472.1:198035:215032:-1 gene:ENSXETG00000030789 transcript:ENSXETT00000063066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPATASVLDLSRNVPVTEGRDNLYRAGQCKKMSPPESGTLHIVYGNGSSVGTVLMFQCS
SMYQLVGEGISTCVWRGNSTLWTSGAPTCKAISRYETFGFKVAVIASIVSCAIILLMSMA
FLTCCLVSCVKKNERRRSEREKVVWHQLDCEGLENVPAEQFGMKGRNNNNNKDGSRPALA
EWISMAYENHGFCRCHDVWAGEVPAAAFGGECSGSGPKPASRGAPSCSVAIQTVSGGHII
EVYGRDKEFMRRFEAQLPE
Download sequence
Identical sequences A9ULD6
NP_001107364.1.99540 gi|163916033|gb|AAI57216| gi|166157909|ref|NP_001107364| gi|213625689|gb|AAI71131| gi|213625703|gb|AAI71157| ENSXETP00000059170 ENSXETP00000059170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]