SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000059378 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000059378
Domain Number 1 Region: 426-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000116
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 2 Region: 906-956
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000011
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 3 Region: 358-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000101
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 484-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000457
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number 5 Region: 122-146,324-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000556
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 6 Region: 850-902
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000656
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000059378
Domain Number - Region: 540-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000769
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000059378   Gene: ENSXETG00000031992   Transcript: ENSXETT00000060267
Sequence length 1139
Comment pep:known scaffold:JGI_4.2:GL172665.1:4014804:4040473:1 gene:ENSXETG00000031992 transcript:ENSXETT00000060267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVQSDRPATAFSTGSVDGIINAPINPQIIQGCIVANPEGSNSEITQYLILQEQDSIHPHL
SVVQENLWRSCLPVSVVDTSSVTVASVPVGERYQTHGSSCAAESMADAESLEGMVEVVFV
QQYKCKMCKYKSTSKPTLLRHVRERHIQPNLTFSASIEEKRSHEGKVARSKEEEEEDEDD
DDIVDAGAIDDPNDDSDYSPGEDTPNNNLESAHGILIKERPRRKPGRPRKIPRIDAHTHI
LPTAYDVDINHVVPAGPKLDIPLSSNDNQTDQGVTNSDLENKDPASLAISEEQSPPKRMR
GRPPKHIRGKKYRRFRGSRPPSKRLLRPFICRICGSSFLTHDDFTFHVTSHVGNDPQAFQ
CQQCSYQCRRWSSLKEHMYNHKGSKPYKCEECEYTSVYKKDVVRHSAVHREDRKKKSEKT
SKPASYPCPVCGRIYTMQKRLTQHMKIHSAEKPHMCDKCGKAFKKRYTFKMHLLTHLQCV
GKSRYKCEFCEYICGDRKQLLNHQLTHMNDKPFKCSQCKYHTYRQDFLLSHMATKHAGGK
HFACDHCHFTTKHKKNLRLHVQSRHPLLYNEWSQRHPEETPSRRRPFFSMQQIEELKQLH
EQSEXPKISSPPTSQSPTEEQSHGALGAAAIIYEQEGEEEEYATRAALDLLLNMSTRREG
TGGPLQVAVVKSGSGGEVQSSQSMAHEPHMAQVLTLHVEGNGVTSVQEAGYEDAGVEDTG
YEGAVQQITIDNAFTTAEYSLINTENIPASLCRMQSGQNKKESETSASPGSTLLGENIKD
KILRKSQQAEVRTGLVTLFCCPSFTAFPVAWLQPPDSHVTCLNHFQTPIHPTPTMLLPHV
SDHSAAPAAKKFCCKLCGTTFLGRSEMEIHKRAHVPSGGFKCPDCIFTAANWPEVRNHLS
VHSDRRPHRCDQCSFACKNKRDLSRHSMIHTNQRPHSCPICGQRFTRKAHLKFHIQRLHR
GKNNEPQENEGQCLHSVLAELTPAPSLEEEHIFLTQEESMASQEDTAYIQEITTADGQTL
QQLVTADNQVQYIISQEDIPHLIPQEYVVLPDGHHIQVQDGQITHIQYESGTPFLQDPQI
HFVPMSPSQQLLTQEQLQAAAHSAVTAVADAAMAQTVFSTETEQPLPQEIEYDIITLGE
Download sequence
Identical sequences F6XR77
ENSXETP00000059378 ENSXETP00000059378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]