SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000060966 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000060966
Domain Number 1 Region: 376-451
Classification Level Classification E-value
Superfamily HMG-box 9.16e-27
Family HMG-box 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000060966   Gene: ENSXETG00000017139   Transcript: ENSXETT00000064129
Sequence length 567
Comment pep:known scaffold:JGI_4.2:GL173065.1:14902:129409:-1 gene:ENSXETG00000017139 transcript:ENSXETT00000064129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LENQEAQQVHLSKMQLRKKRISAKIPVSPSEGIEGHCFKVEEDYEEPALQSGTPPFFTKQ
DYESPPQDTNDLCELQADSSGSGRKEENLQLSKTVRDAMPALEKLLSNDWREILLGTKES
LAEKELQLLFMIHQLTRLRDQLLSAHSEHRNMAAMLFEKQQQQMELARQQQEQIVKQQQQ
LIQQQHKINLLQQQIQHVNMPYVMIPAFPPAQTVTADPQMSLPIQPIPCKPVEYPMSLLH
NSTTRGSVSAKRQETSQPLNLTAKPTDQVPNSRSSPKYRMSPVGSQGGSSMDSASSPQKA
NLPLGFLGEGDAITKAIQEACQLLHGQNTSPEHHQQKYRKELLDTLPEKEVQDGASLQHT
EESVLGCNMDIDGSRGSHIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSM
SNAEKQPYYEEQARLSRQHLERYPDYKYKPRPKRTCIVEGKRLRVGEYKALMKNRRQDTR
QGYVITSIGALQCPPSPSGFSSQSLLDNLSQLPSSDHYNPQDCNIQVVKSHLLVSHEPHG
AIPMAKDICSDSEDSGKSDGELVVITD
Download sequence
Identical sequences F7DNK6
ENSXETP00000037344 ENSXETP00000060966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]