SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000062036 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000062036
Domain Number 1 Region: 110-160
Classification Level Classification E-value
Superfamily Orange domain-like 6.93e-17
Family Hairy Orange domain 0.0022
Further Details:      
 
Domain Number 2 Region: 36-105
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000366
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000062036   Gene: ENSXETG00000016852   Transcript: ENSXETT00000065272
Sequence length 278
Comment pep:known scaffold:JGI_4.2:GL172881.1:69164:71624:-1 gene:ENSXETG00000016852 transcript:ENSXETT00000065272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YIKREPGGGQKMPADLMEKNSSSPVAATPASMSNTPDKPKTASEHRKSSKPIMEKRRRAR
INESLGQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRVQMTAALSTDPSVLGK
YRAGFSECMNEVTRFLSTCEGVNTDVRTRLLGHLANCMNQINAMNYPTQPQIPAAAAPHP
AYGQPLVQLQGAAPQSSPAPIACKMGGPPVEAAKVYGGFQLVPAPDGQFAFLITNPAFPH
NGSVIPVYTNSNVGTALPPSVSPSVMPSVTADSVWRPW
Download sequence
Identical sequences F6ZKJ9
ENSXETP00000062036 ENSXETP00000062036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]