SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000062521 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000062521
Domain Number 1 Region: 8-136
Classification Level Classification E-value
Superfamily Hormone receptor domain 4.71e-24
Family Hormone receptor domain 0.00053
Further Details:      
 
Domain Number 2 Region: 114-390
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000915
Family Rhodopsin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000062521   Gene: ENSXETG00000030788   Transcript: ENSXETT00000063924
Sequence length 435
Comment pep:known scaffold:JGI_4.2:GL172770.1:1125963:1168798:1 gene:ENSXETG00000030788 transcript:ENSXETT00000063924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENLVYMLVLMVPFLLPVHGFHPECRMKLALKQQEMKCMAKLKAQATEISSEKGCIGIWD
NITCWDTARHGEKVTQNCPVALRHILRKQGNITRTCKRTGWTDIYPDIVEACGYNDSEPM
KLNFYIIVQTIYTFGHSVSLIALTIGSTILCLFRKLHCTRNYIHLNMFISFILKAISVLI
KDGFLFSNPESCPESLIGCKVILVLMQYCVMANFYWLLVEGLYLQTLLVVIFTSHKLFIV
YLLIGWGIPTIFIIIWIVSRVYLDDTECWDTNDHSVPWWIIRIPIIISITLNFCLFINII
RILLQKLLSPDVGGNDQSQFKRLAKSTLLLIPLFGVHYMVFVGFPMPSFSDCQIWFELCV
GSFQGLVVAILYCFLNTEVQGELKRKWRSLDYIRYKKHDKRMHSLTISRNGSEGVPQFHR
DSRAQSIMQTETTMI
Download sequence
Identical sequences B1WBH3
gi|171847176|gb|AAI61755| gi|187607730|ref|NP_001120616| NP_001120616.1.99540 ENSXETP00000062521 ENSXETP00000062521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]