SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000062872 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000062872
Domain Number 1 Region: 933-1012
Classification Level Classification E-value
Superfamily HMG-box 9.95e-23
Family HMG-box 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000062872   Gene: ENSXETG00000030813   Transcript: ENSXETT00000061990
Sequence length 2213
Comment pep:known scaffold:JGI_4.2:GL172845.1:1288349:1301555:-1 gene:ENSXETG00000030813 transcript:ENSXETT00000061990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLGRWEMPSSRKTATFKSKAPKKKYIEGHGSQEGQEDSSSSSEGPATLQDCSGEQPVTSV
IVSEERCHSVRSSSTDTASEHSADLEEEAEKTRIDIAPSSGHCTDLGFHHLRQQRILVRR
EESFQLCQVKQFRQNQVGVQFPGEQPLTFVDITQHLVLLDKIPQLGEVEVGVPVCFCMNP
DDTLFREGIVVEVVQNPLSYNVCIQQSPGRREREYRLVPHSCIRLLRSPWCKESVLATPQ
NAEEKKQQASGSSMELPVSPRGTEQKHLEDAEVSKISFSMPEEKLSSIQQRILSPPKSPA
FGIMLGRLPEQPSPLLSPDAGSRSSCSSVSLDKCSTPGSRSRTPLTAAQQKYKKGDVVCT
PNGIRKKFNGKQWRRLCSRDSCMKESQRRGYCSRHLSMRTKEMESMSEGRGGREGSAEFE
WDDTSRDSEVSSIRTDSRPRLVAPTDLSRFDFDECEAANMLVSLGSSRSGTPSFSPVSNQ
SPFSPTPSPSPSPLFGFRPANFSPINASPVIQRARSRHVSASTPKGGTVLTPEMLHHSHH
RERQAVGILPSFQTNLTFTVPMSPSKRKPDSHHGSASSAADFQKSDSMDSGVDSVSHTPT
PSTPAGFRSVSPAPIFSRSQQASPSQLLSPPAGLTSDPSPSVRRVPAVQRDSPVIVRNPD
VPLPSKFVEKLSDGASRNIGGAASGGSSPRRLSKVCSKDHPSKTQLQIPVPINATQMQSA
ARTLPPGQQSISSPFQPVAFHPSPAALLPVIVPSDYASHPVPKKEIIMGRPGTVWTNVEP
RSVAVFPWHSLVPFLAPSQPDSSVQPSEGQQPVNHPGASNQSKEPPESASVAHDAMPVAS
IEDERCAVPRTDNVSQPPTEEPAKQLQHQESMTQGTTGDQRGDSETESDHDDAFFPIGPP
DLQLPMHGGKRRTQSLSALPKERDSSSEKDGRSPNKREKDHIRRPMNAFMIFSKRHRALV
HQRHPNQDNRTVSKILGEWWYALGPKEKQKYHDLAFQVKEAHFKAHPDWKWCNKDRKKSS
SDVKQVMPGPWGVPKEMRERSMSETGTMAAAGTAAEVPPSGLLLGTESKLGASTSTLGPG
LPPSSSSSTQISRPRAFSHSAVQSIEHREDSQALQELKQMCSNRSPYPVQKAAFGGPDSS
SFPVPAHSEAPTCPASRACSSLPGSYHPQRTASEDMTSDEERMVICEEDGDDDVIADDGF
GCPDIDLKCKERVTDSDSDGRSGDEVEGKVQPQRVFSPVIRASSLSERLQNMAQSPKPSD
HPQPSYPRGYPPLPPAKPPPRPTTQHPTKRNPEVRFTMVDPSSSYKRKRSVDGGQKAVGE
GAAPTGQYSTQSVISSGHSQPLVLPSLPSNHPSSSMYSSAPKSYEGHRGISDSRPPVPTV
GTVLVSGPQGLRPASTAVTNVVRPVSSTPVPIASKPLPVSRSSSISDLSESRIPGSPVGI
GVLYAHDRKPMQQLTSPANSPHSQSKPAGGIVTNLVVGAPSYGQPAPTTGNGTVPAPVTA
LQFITQNSAGNSNGAVPLRILQPQELLPATASKRGSITQVQYILPTIPQQLPGGTAASIH
FTLPPANAKMIATPQALPIVQPGPAASPSPAQSVSPAPSSGSSTQLLVQGKMLVPMATPH
VTVRTGSAAPLPLVTPPFPVQNGAQPTNKIIQITPMPVVHSPAPAQSALVPPGSSPLHNA
IPVTMATAAVMAASSQPQKVVLPSSTRITYVPSAGVPTVPLVTSSSHSQTAPSGSAPCVQ
SMALGFTAIGPNGQTIVQPLITGQSQLLAQGQVAVSPASTPPVPQTCSGQVLTAIYPSVG
SNTLTVPAPPAAQSVVYTVASTNTISTVPATILPKAITSPQTISSPPAPCIAGSSSQTTP
ATAASVTFSLVTSKSPRNLPKPPQKVKATIASIPVGSFEGTSPSPCVRNTARPSPLPPCE
ETPEPREIWVKNMTDDSSASPLPDDRREPPHSPSIKKEPGCSSEFKVTETRLDSNPPTGL
PAPSSPVTLPTTQSGEAAKAGTSLSEAPERKDGPVKKVKVRPPPLKKTFDSVDNRVLSEV
DFEERFAELPEFKPEEVLPSPTLQSLATSPRAILGSYRKKRKNSTDLDSSTEDPVSPKRK
MRRRSSCSSEPNTPKSAKCEGDIFTFERTGNEAEDLLGEMEYDKAPYSSLRRTLDQRRAL
VMQLFQEHGFFPSSQSTAAFQSRYSDIFPTKVCLQLKIREVRQKIMQAATPTE
Download sequence
Identical sequences F6Z0V1
ENSXETP00000062872 ENSXETP00000058412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]