SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000063549 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000063549
Domain Number 1 Region: 310-520
Classification Level Classification E-value
Superfamily Kelch motif 3.53e-60
Family Kelch motif 0.00000752
Further Details:      
 
Domain Number 2 Region: 35-152
Classification Level Classification E-value
Superfamily POZ domain 4.45e-33
Family BTB/POZ domain 0.00063
Further Details:      
 
Domain Number 3 Region: 512-592
Classification Level Classification E-value
Superfamily Kelch motif 1.28e-22
Family Kelch motif 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000063549   Gene: ENSXETG00000034185   Transcript: ENSXETT00000064666
Sequence length 595
Comment pep:known scaffold:JGI_4.2:GL172746.1:2372469:2416973:1 gene:ENSXETG00000034185 transcript:ENSXETT00000064666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKVPPEAFCRNSKVSNQKPTDVKDNGEKFCPITVNPRHTRKAFKVMNELRSQNLLCDVTI
VAEDVEIAAHKVVLASCSPYFHAMFTEGEMSESRAKRVRIKEVDGWTLKMLVDYVYTAEI
KVTEENVQVLLPAAGLLQLQDVKKTCCEFLESQLHPSNCLGIRAFADMHACTDLLNQANG
YAAEQHFSDIVTGEEFLNLGIEQVCSLIASDKLTVVSEEKVFEAVIVWVNHDTEVRQEHM
SHLMEHVRLPLLSRDYLVQRVEEETLVKNSSACKDYLIEAMKYHLLPGDQRTLIKSARTR
QRTPVSMPKLMVVVGGQAPKAIRSVECYDFKEEQWHQLAELPSRRCRSGVVYMSGHVFAV
GGFNGSLRVRTVDSYDPVKDQWTSVANMQDRRSTLGAAVLNGLLYAVGGFDGSTGLATVE
AYNIKANEWFHVAPMNTRRSSVGVGVVGGMLYAVGGYDGASRQCLSTVECYNPSTNEWSY
ITEMGTRRSGAGVGVLNGLLYAVGGHDGPLVRKSVEVFDPSTNTWKQVADMNMCRRNAGV
CAVEGMLYVVGGDDGSCNLASVEYYNSTTDKWTLLPSCMSTGRSYAGVTVIDKPL
Download sequence
Identical sequences F7ECS4
ENSXETP00000063549 ENSXETP00000063549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]