SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000063812 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000063812
Domain Number 1 Region: 54-328
Classification Level Classification E-value
Superfamily L domain-like 1.43e-39
Family Ngr ectodomain-like 0.021
Further Details:      
 
Domain Number 2 Region: 558-645
Classification Level Classification E-value
Superfamily Fibronectin type III 2.18e-16
Family Fibronectin type III 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000063812   Gene: ENSXETG00000005513   Transcript: ENSXETT00000060823
Sequence length 719
Comment pep:known scaffold:JGI_4.2:GL173086.1:25569:34354:-1 gene:ENSXETG00000005513 transcript:ENSXETT00000060823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFIGANYLGLLLLLLACLKQVQVMAQQSVVPETKGTTLFHVTTQNVPGYSTEKPCKELHH
GRNISLSSRSLSVFPQCLPSDTEALDMSNNSLTTITQPSLSRFSQLQWLDLKDNQIQDIY
CGSDVLENLEYLDLSSNNLSDVPRCSKLQRLKWLSLARNPISQIQDFAFSYFPSLVFLNL
SYTELGKSPSGDLSVFSFALKVPGAPVKSSIETLDLSSTFLSEVGPFWTSYLKNLKELYL
RSMSNIKTLEKILTLDFPRLELLSCAHSSALASLDQSLFENGSHLKHVDLENCNLTAVPQ
WNISSPHLSLVLLGNPLACRCDMTWLVSEQINVTLIRANETLCRQGDGLEISLVQLNGEC
QKKPTPYATVNNTPTAANSLNDSVVFTSTPLHLTPPHETSTVPLDKATITQKVEKNTGII
TVFKQTSSDSFNGQHQNPATQATTVLLEGTNVPTTSFGKSEAATKYFSGTSLSKDSGLTL
RTSQITQPPPTVSKKPNISVPLELPEMHTGDYYYDDTQQTTTLKSTSKPCDYKPCRHLQT
ECHELQRLTPCFCPGLTGNNVPPDPPMMQGASEITDTSAQIHWCAPNSRVGKYQLIYRPE
GDKNQTVVDNIYITSRKYTLYNLLPDTTYHICALSFNTAGSSQPLNDDSRFPCTEFRTKP
SYVGILAALCTVAGVAMVAIIVLSVYLYKACRNNLINQYDTRLVSYKNPAFEYQIPFWE
Download sequence
Identical sequences F7DXZ8
ENSXETP00000063812 ENSXETP00000063812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]