SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|112932|sp|P28824| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|112932|sp|P28824|
Domain Number 1 Region: 273-425
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.06e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000000572
Further Details:      
 
Domain Number 2 Region: 428-586
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.92e-43
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000000766
Further Details:      
 
Domain Number 3 Region: 647-804
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-37
Family MAM domain 0.0007
Further Details:      
 
Domain Number 4 Region: 35-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-31
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 5 Region: 146-264
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-30
Family Spermadhesin, CUB domain 0.00000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|112932|sp|P28824|
Sequence length 928
Comment RecName: Full=Neuropilin-1; AltName: Full=A5 antigen; AltName: Full=A5 protein; Flags: Precursor
Sequence
MLLRLLSCCCWLLCSLRSSWASRNDKCGDTIKITSPSYLTSAGYPHSYPPSQRCEWLIQA
PEHYQRIMINFNPHFDLEDRECKYDYVEVIDGDNANGQLLGKYCGKIAPSPLVSTGPSIF
IRFVSDYETPGAGFSIRYEVFKTGPECSRNFTSSNGVIKSPKYPEKYPNALECTYIIFAP
KMQEIVLEFESFELEADSNAPGGQTCRYDWLGIWDGFPGVGPHIGRYCGQNTPGRVRSFT
GILSMIFHTDSAIAKEGFFANFSVVQSNTDEDFQCKEALGMESGEIHFDQISVSSQYSMN
WSAERSRLNYVENGWTPGEDTVKEWIQVDLENLRFVSGIGTQGAISKETKKKYFVKSYKV
DISSNGEDWITLKDGNKHLVFTGNTDATDVVYRPFSKPVITRFVRLRPVTWENGISLRFE
LYGCKITDYPCSRMLGMVSGLISDSQITASSQVDRNWVPELARLVTSRSGWALPPSNTHP
YTKEWLQIDLAEEKIVRGVIIQGGKHKENKVFMRKFKIGYSNNGTEWEMIMDSSKNKPKT
FEGNTNYDTPELRTFAHITTGFIRIIPERASASGLALRLELLGCEVETPTSIPTTPEVNG
GDECEGDLANCHSGTDEGFKLTVGATGQSTETPTVEASPEEPDMTHSDLDCKFGWGSQKT
VCNWQHDISSDLKWAVLNSKTGPVQDHTGDGNFIYSEADERHEGRAARLMSPVVSSSRSA
HCLTFWYHMDGSHVGTLSIKLKYEMEEDFDQTLWTVSGNQGDQWKEARVVLHKTMKQYQV
IVEGTVGKGSAGGIAVDDIIIANHISPSQCRAPEIDDSANKIGEEDSEIDKTGSTPNYAL
NEFNESISKKPGNVLKTLDPILITIIAMSALGVLLGAICGVVLYCACWHNGMSERNLSAL
ENYNFELVDGVKLKKDKLNTQNSYSEAS
Download sequence
Identical sequences P28824
gi|112932|sp|P28824|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]