SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|114108077|gb|AAI23201| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114108077|gb|AAI23201|
Domain Number 1 Region: 21-162
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.64e-29
Family Glutathione S-transferase (GST), C-terminal domain 0.0000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|114108077|gb|AAI23201|
Sequence length 181
Comment MGC154434 protein [Xenopus laevis]
Sequence
METSQWQKAILLYLARKYKTPDHWYPSDLQKRARVDEYLAWQHTNTRPNSAKVFWTKCVS
PTLLGKEAPREKLDAVLADFNTTMKNLEEKFLGNKPFIAGDEISVADLVAIVEIMQVIAG
GVNVFEERPKLGAWKQQVVEAVGEDLFQEAHEWILSFSKQKFEPLPAELLQRLKSSPLYK
D
Download sequence
Identical sequences Q0IHD7
gi|114108077|gb|AAI23201| gi|148235267|ref|NP_001090341| NP_001090341.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]