SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116487815|gb|AAI25975| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116487815|gb|AAI25975|
Domain Number 1 Region: 419-670
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.22e-69
Family Eukaryotic proteases 0.0000533
Further Details:      
 
Domain Number 2 Region: 21-133
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-29
Family Spermadhesin, CUB domain 0.0000103
Further Details:      
 
Domain Number 3 Region: 176-289
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-24
Family Spermadhesin, CUB domain 0.0000427
Further Details:      
 
Domain Number 4 Region: 360-431
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000375
Family Complement control module/SCR domain 0.0003
Further Details:      
 
Domain Number 5 Region: 295-363
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000118
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 6 Region: 129-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000181
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116487815|gb|AAI25975|
Sequence length 687
Comment LOC733422 protein [Xenopus laevis]
Sequence
MDLSWFLILALLGCVHSSIPSMYGEITSPNYPQGYPNNVEETWEISVPEGFGIHLYFIHL
DIEPSESCEYDYVQVIVGDIVEKKLCGHQSGRSQRRPVEEKFFHSSYLKLLFKSDFSNQQ
RYTGFAAYYIAVDINECKDTSETLCSHFCNNYIGGYFCSCPPEYFLHPDNHTCGVNCSGG
LFTDNKGTIRSPGFPSPYPENTRCEYKVQMEHGFEVIIIFQGEDFDIEADKDGNCYDSLT
IKAGARKFGPFCGKNSPNPPVIETGSNEADIIFQTDSGGENRGWKVRYYGDAIQCPMQVI
PNSVLDLQQEKYVFRDVVTVTCLEGYEIVKEKKTLKSFRSTCQGDGTWKNSHFQCQQVNC
GEPDPIDNGIVTLNRSSTTYGSKIEYSCPTEYYTLTLPAGEDGTYRCSSDGYWVNKKGEK
ELPTCTPVCGVDHSVDGARIFGGAQAKLGQFPWLIQFTVPELGGGSLISDRWVLTAAHVL
KNEFPEMYGGVMKLFPNVNSRPKQNKLQFKKIIVHPLYRGGENYDNDIALIQLSKKVKMD
KCISPICLPRRGLAPVVNEVALIAGWGRTKKRDYAINLQFAKIFLSSMDKCKQATAGGGY
ITANMLCAGSEDGRDSCQGDSGGPLMFKDPQDSSKIYMAGIVSWGPQECGSYGFYTKVDN
YLDWIEKTIAATEREEQEEVETQVLCA
Download sequence
Identical sequences A0JMR1
NP_001089125.1.7800 gi|116487815|gb|AAI25975| gi|148228092|ref|NP_001089125|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]