SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|117558247|gb|AAI26040| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117558247|gb|AAI26040|
Domain Number 1 Region: 216-378
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 6.87e-45
Family Pentapeptide repeats 0.00024
Further Details:      
 
Domain Number 2 Region: 89-189
Classification Level Classification E-value
Superfamily POZ domain 2.36e-28
Family Tetramerization domain of potassium channels 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|117558247|gb|AAI26040|
Sequence length 389
Comment Kctd9 protein [Xenopus laevis]
Sequence
MRRVTLFVRGSPLHGKVIPVTGSLSDLLSLASITFGIQATQVFNENGGQIDDISLIRDDD
VLYVAEEESEVDPMASFEIPEQLTGGHTDWLTLNVGGRYFTTTRSTLVSKEPDSMLSHMF
SDGDAWGNKRDHTGAFLIDRSPEYFEPILNFLRHGQLIVNDGVNLLGVLEEAKFFGIDSL
IEHLEVAIKNSQPADDHSPISRKEFIRFLLATPTKSELRCQGLNFSGADLSRLDLRYINF
KMANLSRCNLAHANLCGSCLERADLSGSVLDGANLQGVKMLCSNAEGASLKGCNFEDPSG
LKANLEGANLKGVDMEGSQMTGINLRVATLKNAKLKNCNLRGATLAGTDLENCDLSGCDL
QEANLRGSNVKGAIFEEMLTPLHMSQSVR
Download sequence
Identical sequences A0JMX3
NP_001091383.1.7800 gi|117558247|gb|AAI26040| gi|147901430|ref|NP_001091383|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]