SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|120538281|gb|AAI29654| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120538281|gb|AAI29654|
Domain Number 1 Region: 82-213
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.59e-29
Family Glutathione S-transferase (GST), C-terminal domain 0.000064
Further Details:      
 
Domain Number 2 Region: 2-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.16e-20
Family Glutathione S-transferase (GST), N-terminal domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|120538281|gb|AAI29654|
Sequence length 243
Comment LOC100036918 protein [Xenopus laevis]
Sequence
MADFTLYLDLMSPPCRSVYIFAKANNIPFNNHQMRIFKGEHLTEDFGKVNVLRKLPALKD
GDFSMAESTAMLIYLARKYKTPDHWYPSDPQKCAHVDEYLAWQHTNTRPHGVKVFWAKFM
TPLILGHEAPREKVDAILADFNIAMKNLEEKFLGNKPFITGDEISVADLVAIVEIMQVVG
GGVNVFDERPKLADWKQRVVEAVGEEVFLEAHEGILNCKKRASEPLPPELLELLKCKLLS
MIQ
Download sequence
Identical sequences A1L2Q3
NP_001091161.1.7800 gi|120538281|gb|AAI29654| gi|147902605|ref|NP_001091161|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]