SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|120577482|gb|AAI30057| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120577482|gb|AAI30057|
Domain Number 1 Region: 52-174
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.61e-18
Family Thioltransferase 0.00000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|120577482|gb|AAI30057|
Sequence length 187
Comment LOC495430 protein [Xenopus laevis]
Sequence
KFFTYTAVFLCCRLETLLKMRYLSAAGLLMLSVCLLFLTPGFADTGLGRGFGDHIHWRTL
DDGKKEAAASGLPLMLVIHKTWCGACKALKPKFAESKEISELSHNFVMVNLEDEEEPKDE
AFSPDGGYIPRILFLDPTGKVHPEIINSKGNPSYKYFYNTAEQVTEAMKEAQEKLTGDSF
MKHTDEL
Download sequence
Identical sequences A1L3E7
gi|120577482|gb|AAI30057|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]