SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|120577602|gb|AAI30102| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|120577602|gb|AAI30102|
Domain Number - Region: 111-148
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.0811
Family N-terminal coiled coil domain from apc 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|120577602|gb|AAI30102|
Sequence length 444
Comment LOC100037009 protein [Xenopus laevis]
Sequence
PHPRLELQRIMQSSAGGALCRPLVPTCCSAPMSVPGGGRSSAGSRRRASPPVTMRDTYGT
SSVSSSTSGSYKGSDSSPSSRRQNKYSLCSENHGIKPPTPEQYLTPLQQKEVYIRHLRAR
LKDMQDALHERDTEVDELRSQLSRMQEDWIEEECHRVEAQLALKTAQREIQQLRDVMENG
REGLGENDSGVQKYFADMTLQNRKLETLLQNMELAQDGTEGVGSSGESPARSLTRSSTYT
KLSEPHAEEHHSQDTGDSGFAAPDDSSAVSSGTEFCLGEGPLCIEVHPAPLCAEAAVQAS
NVSDCGVQTDVVPETPEPDNIFEKVSLSHLAGNDITQKPLVQEEVTVTSDSSCVVLVTDG
IPGESGAEEHESPPHNYWSRHFVVDLLAVLIPVVPTVAWLCRAPRRQGQPVYNISSLLRG
CCSVALHSIRRISCRPVSPPPSQP
Download sequence
Identical sequences A1L3H5
gi|120577602|gb|AAI30102|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]