SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124481724|gb|AAI33198| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124481724|gb|AAI33198|
Domain Number 1 Region: 567-821
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.99e-89
Family Eukaryotic proteases 0.0002
Further Details:      
 
Domain Number 2 Region: 11-309
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.85e-78
Family Eukaryotic proteases 0.0005
Further Details:      
 
Domain Number 3 Region: 1296-1529
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.71e-72
Family Eukaryotic proteases 0.0000765
Further Details:      
 
Domain Number 4 Region: 445-547
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-34
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 5 Region: 1134-1236
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-29
Family Spermadhesin, CUB domain 0.00094
Further Details:      
 
Domain Number 6 Region: 991-1099
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-27
Family Spermadhesin, CUB domain 0.00099
Further Details:      
 
Domain Number 7 Region: 321-427
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-22
Family Spermadhesin, CUB domain 0.0009
Further Details:      
 
Domain Number 8 Region: 848-962
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-20
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124481724|gb|AAI33198|
Sequence length 1530
Comment LOC398190 protein [Xenopus laevis]
Sequence
RMGSWGMMVSITLLLWVAACISAKISNLEPQQESPIPGETAELKCGTRPEIGDEPDLEFT
SRIVGGGDAAVGGQPWTVSLKLNERHICGGSIVRKDMVVTAAHCVYPVTEIKVSHMTVIV
GEYDQQVMDSQEQSIPVSHIEPHPNYRGDGNMGYDIALVFLSKPIIFGSQVQPICLPQVG
EKIEAGTLCVSSGWGRLEENGDLSPVLQEVKLPVIDNGTCHAVLEPIGHPVLDDTMLCAG
FPEGGMDACQGDSGGPFVCRRRSGVWFLAGCVSWGLGCGRSWGAKQIIRSQSGSPAIFSR
VSSVLDFLRPPKLTGGCSSKGRTITGKNGTVRYPLSGNYSINSVCRWMLAVQKAKMIEIR
FLQLDIEDHATCTFDYLSFTVNEKMIRKVCGSTIPSPLIVRSNKVTVTFFSDGTFTGRGF
EIQFLAIPTKAASACGSAKILKKKGMIYSPNYPDPYPRLKTCSWIIEAPENHIVKLKFED
FNVEYGHGCIYDAVEVYDGAEEKQLIARLCGYTLPLPISSPENTMLIRFKTDMENSYPGF
KVKFSFVPKEKQFSLPVDDTPTISMLHPRAIALDVCGMAPMTPKWWLPRIVGGEEASPNS
WPWQVQIFFLKTFHCGGAIISPQWILTAAHCIQAAEPSYWTVIAGDHNRMLNESTEQIRN
IKTIRIHDNYNSETYDNDIALLYLEEPLDLNDFVRPVCLPEPEEVLTPASVCVVTGWGNT
AEDGQPALGLQQLQLPILDSIICNTSYYSGELTDHMLCAGFPSTKEKDACQGDSGGPLVC
QNEKEQFSIYGLVSWGEGCGRVSKPGVYTKVRLFFTWIQNTQQDLQQENALLNSKSVEQR
EGKAAGGCSSDVLVEELVGLIASPGYPFGYAGGLRCSWVIEAAPFSIIKLTLKDLSIEES
EDCLNEFLAIYLDDSIDKKVTRCGSLHNKVTYSSSAQRVGVHFQSGDGGSNRNQGFFLQY
WIYSVQVPDLAEFTGLSQGPRYGSSCEDVILTSSEGVIESPNYLGNYPDDLHCQWRIIAP
VGKVIRVDLLELKTEKDVSGCQDPLLVYNGIGESKDLLGVYCGEIRSISLKSEGSEITLI
FTSNSEVSGKGFSLKYSFWDKQAGSKQLEENAASVGCPALDLIQPESMEPGSAELESPNF
PSLYSNEMDCQWIIYSKYGKKLQIEVLYLNLEASPNCSWDYLNIYDGPNNSSHLLASLCG
HQQDLVFHSNGTFVTLHFHSDKSVVDWGFKIQYGAVPEPSDTLRSLDVPESESDDSEPDE
SETKQQKDQCGNTTVDPMMLYMARSGKIRNLNKGGKESGRVVGGQQAAPRSWPWLVSIQN
SKKRHYCGGIIITNKWILTAAHCEVKINLHRVVVGHTDLTEVQNEHALVINSHVHELYMP
GSSPPRNDLLLLELDTPLLLNNSVAVICLPDDVTTDWTQAECLVAGWGVTDVGGMTLPTK
LQQAKVPIVSTKKCKDYWVSDVTDNNICAGKAGASSCMGDSGGPLICKREDRYYLVGVVS
WGSGKCDVKAPSVYTLTSAFMDWISQHMDT
Download sequence
Identical sequences A2RV65
gi|124481724|gb|AAI33198|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]