SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125858711|gb|AAI29560| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125858711|gb|AAI29560|
Domain Number 1 Region: 19-101
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.54e-25
Family MHC antigen-recognition domain 0.00015
Further Details:      
 
Domain Number 2 Region: 102-196
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-20
Family C1 set domains (antibody constant domain-like) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125858711|gb|AAI29560|
Sequence length 245
Comment LOC100037177 protein [Xenopus laevis]
Sequence
MISVCALLVLGLKASDAVTVDYFDFGAEYYQTYGPSGEYLFDYEGNEMFHVDLESKSVVW
TLPGLEKYTSFDPQGGLQNINVDKFNLDIMMKVSNFTAATNIAPLVSVYTTKPVVLGEPN
ILICCVKNIFPPVMNTTWIKNGEKMTVGFSETSFLPAQDHSFGRLHYLAFLPNEHDIYTC
EVEHWGLEKPTRRVWKHDVPTPVSEAYQNAICALGLAVGIIGIIAGVMLIIKGMKQSAAQ
GRSQH
Download sequence
Identical sequences A2VD70
NP_001091340.1.7800 gi|125858711|gb|AAI29560| gi|147903956|ref|NP_001091340|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]