SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125859023|gb|AAI29642| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125859023|gb|AAI29642|
Domain Number 1 Region: 35-144
Classification Level Classification E-value
Superfamily Immunoglobulin 2.43e-20
Family V set domains (antibody variable domain-like) 0.0000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125859023|gb|AAI29642|
Sequence length 245
Comment LOC100037196 protein [Xenopus laevis]
Sequence
MEPSGLRTPCSLLALVLLSALVLTPTLAIEVYTDREVYGTAGSRVTLSCSFWSSEWISDD
ISVTWHYQPDHSREMYSIVHFAKGLSSIDAGIFKDRIEWVGSPKWKDASIVVHNLELTDN
GTFTCDVKNPPDVVGKSSYVHLQVQEKGPARAGLILGIIIAVALALVIVVTILILLIRYC
WLRRKARVQRELSALERGKLHKAKDSSKRSSRQTPILYAMLDQTRGKSSEKKAKGGIGDS
RKDRK
Download sequence
Identical sequences A2VD98
NP_001091356.1.7800 gi|125859023|gb|AAI29642| gi|148223848|ref|NP_001091356| gi|239977508|gb|A2VD98|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]