SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|1314318|gb|AAC59874| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|1314318|gb|AAC59874|
Domain Number 1 Region: 53-172
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000837
Family Spermadhesin, CUB domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|1314318|gb|AAC59874|
Sequence length 321
Comment CRF-binding protein [Xenopus laevis]
Sequence
MTPASRPDWCLILLFLAVLRGESRYIQMREAAEDALFLLNSDFKRELSEGQIYRRSLRCI
DMLSIEGQFTFQADRPQLHCALFLIGEPEEFIIIEYNFVNIDCIGGDILKVFDGWIIKGE
KFPSSLDHPLSTMERYTDICEDGDVGSITRSSQNVAMIFFRVQQPGHGFTLTIRKIPNLF
PCNVISQSMNGRFTMITPHQHRNCSFSIIYPVVIKIFDLTLGHFNELQLKKPPPKGCGDA
GDFVELLGGAGLDPSKMFPLADLCHSFHGSAQMKIGCDNTVVRMVSSGNFINRVTFEYNQ
LDRQLEKKQGNSVEEACFPSD
Download sequence
Identical sequences A0A1L8HRG8 Q91653
NP_001079273.1.7800 gi|120538073|gb|AAI29662| gi|1314318|gb|AAC59874| gi|148235560|ref|NP_001079273| gi|2498255|sp|Q91653|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]