SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|1345610|sp|P98070| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|1345610|sp|P98070|
Domain Number 1 Region: 89-282
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.45e-60
Family Astacin 0.000084
Further Details:      
 
Domain Number 2 Region: 404-508
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-37
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 3 Region: 554-664
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-36
Family Spermadhesin, CUB domain 0.00031
Further Details:      
 
Domain Number 4 Region: 285-396
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-34
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 5 Region: 509-552
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000311
Family EGF-type module 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|1345610|sp|P98070|
Sequence length 707
Comment RecName: Full=Bone morphogenetic protein 1; Short=BMP-1; Flags: Precursor
Sequence
MDYSYDLEEVVEETIDYKDPCKAAAFWGDIALDEEDLANFKIDRIVDLTKHTIHTVSGAA
TNISRPEKGRRTRKERRRSREKRASTSRPERVWPDGVIPYVISGNFSGSQRAIFRQAMRH
WEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGH
VIGFWHEHTRPDRDDHVSIIRENIQPGQEYNFLKMEPEEVESLGETYDFDSIMHYARNTF
SRGIFLDTILPKYDVNGVRPPIGQRTRLSSGDVAQARKLYKCPACGETLQDSQGNFSSPG
FPNGYSAYMHCVWRLSVTPGEKIILNFTSLDLYRSRLCWYDYIEVRDGFWKKAPLRGRFC
GDKIPESIISTESRLWIEFRSSSNWVGKGFQAVYEALCGGEVKKDSGHIQSPNYPDDYRP
NKACVWKLSVSEGFHVGISFQSFEIERHDSCAYDYLEIRDGSSETSPLVGRFCGYDKPDD
IKSSTNQLWIKFVSDGSINKAGFSLNYFKEVDECSRPNNGGCEQRCVNTLGSYKCACDPG
YELGQDKKSCEAACGGFLTKLNGSINSPGWPKEYPPNKNCIWQLVAPTQYRISLKFDQFE
TEGNDVCKYDFVEVRSGLTSDSKLHGKFCGSELPAVITSQYNNMRIEFKSDNTVSKKGFQ
ANFFSEKKNNIQKLQQLNEVNRGQQNQAPKRVRPRMRLRTVKKTRPP
Download sequence
Identical sequences P98070
gi|1345610|sp|P98070| gi|406541|gb|AAA16313|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]