SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147898905|ref|NP_001086723| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147898905|ref|NP_001086723|
Domain Number 1 Region: 262-398,433-642
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.49e-89
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000383
Further Details:      
 
Domain Number 2 Region: 648-815
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 8.41e-38
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00011
Further Details:      
 
Domain Number 3 Region: 80-185
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000000181
Family Glutathione S-transferase (GST), C-terminal domain 0.03
Further Details:      
 
Domain Number 4 Region: 845-897
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.000000000000667
Family a tRNA synthase domain 0.0021
Further Details:      
 
Domain Number 5 Region: 399-433
Classification Level Classification E-value
Superfamily Methionyl-tRNA synthetase (MetRS), Zn-domain 0.0000000000562
Family Methionyl-tRNA synthetase (MetRS), Zn-domain 0.0019
Further Details:      
 
Weak hits

Sequence:  gi|147898905|ref|NP_001086723|
Domain Number - Region: 1-67
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00016
Family Glutathione S-transferase (GST), N-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|147898905|ref|NP_001086723|
Sequence length 905
Comment methionyl-tRNA synthetase [Xenopus laevis]
Sequence
MKLFVAEGNPHGVKVLAAAALWGQHVQINRLQQEEKIVPFMSQPRLPALDLENGNFLFLS
NAICRYFYLSCGHDMCDQSNQWLEWEAVELQPALSAALYAHVVQGKKKEDVLVTVSASLR
HLDQSLAGKSSPYLVKDVLTVVDIVVWGSIYPLIVDASSLPEEMTSLKRWFQNLNQLEQC
QKAASSLFKDEGSSVFKPYLQKQPAAITPSGKPICNEQEGEDIESLSEEDIQAAAEAWAK
GLSGAPKPKLQPHPILPVEGEKNILITSALPYVNNVPHLGNIIGSVLSADVFARYCRLRN
WNTLYICGTDEYGTATETKAMEEGLTPQQICDKYNAVHTAIYQWFNISFDYFGRTTTQQQ
TTIAQDIFHRLLERDFLLTDTVEQLRCETCKRFLADRFVEGICPFCNYEEARGDQCDKCG
KLINAVELKKPQCKVCKQSPVIKSSKHLFLDLPKLEKRLEQWLEQSFSSGDWTSNARFIT
RSWIRDGLKPRCITRDLKWGTPVPLDGFRDKVFYVWFDAPIGYISITANYTDQWEMWWKS
PQQVQLYNFMAKDNVPFHSVIFPSCLLGAEDNYTLVNHLVATEYLNYEDGKFSKSRGVGV
FGDMAQETGIPADIWRFYLLYVRPEGQDSAFSWSDLMLKNNSELLNNLGNFVNRAAMFVQ
KFFNGCVPEMELLSEDKRLLAQVAAELQQFNQLLEKVRIRDALRCILNISRHGNQYIQVN
EPWKCIKGNQEEQKRAGTVTGVAVNMAALLSVMLHPYMPTISGVIQEQLLMPQESKVLTT
DFCCRLQSGHRIGNVSPLFQKLENDQIESLRKRFGGGQVKTESKVPPSQEAPLQKTPKAS
GPERVKELMQEVEKQGNHVRELKGKKAEKSTIDSEVQKLLALKKELALAEGKSPDPPAQK
GKKKK
Download sequence
Identical sequences Q6AZT3
NP_001086723.1.7800 gi|147898905|ref|NP_001086723| gi|50603650|gb|AAH77353|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]