SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147900265|ref|NP_001084375| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147900265|ref|NP_001084375|
Domain Number 1 Region: 172-260
Classification Level Classification E-value
Superfamily eEF-1beta-like 1.44e-36
Family eEF-1beta-like 0.00000446
Further Details:      
 
Weak hits

Sequence:  gi|147900265|ref|NP_001084375|
Domain Number - Region: 55-93
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.0209
Family N-terminal coiled coil domain from apc 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|147900265|ref|NP_001084375|
Sequence length 260
Comment elongation factor-1 delta [Xenopus laevis]
Sequence
MSASVIATEQVWLDKYKYDDAERQYYENLSGGSSPNNPHNSPQSAAPSNSGDGSELAARV
ANLEQENQSLHKVVKDLQSAISKLEIRLSTLEKSSNSQKPAAAPQPVIKVAAPVQKVQVT
PAKEENGTGEDDDDDIDLFGSDDEEEDAESARLREERLKQYAEKKSKKPGVIAKSSILLD
VKPWDDETDMAKLEECVRTVQMDGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDILEE
EITKFEDYVQSVDIAAFNKI
Download sequence
Identical sequences Q91733
NP_001084375.1.7800 XP_018121899.1.7800 gi|147900265|ref|NP_001084375| gi|46329749|gb|AAH68905| gi|56970676|gb|AAH88696| gi|886724|gb|CAA59420|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]