SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147900426|ref|NP_001084924| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147900426|ref|NP_001084924|
Domain Number 1 Region: 103-232
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.64e-29
Family Glutathione S-transferase (GST), C-terminal domain 0.0000761
Further Details:      
 
Domain Number 2 Region: 22-121
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.61e-28
Family Glutathione S-transferase (GST), N-terminal domain 0.0000689
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|147900426|ref|NP_001084924|
Sequence length 241
Comment hypothetical protein LOC431979 [Xenopus laevis]
Sequence
MTGSEKCLAKGCPAPGPVPEGTIRVYSMRFCPYAQRARLVLAAKGIKHEVININLKNKPD
WFFEKSPFGLVPSLETSNGQVIYESPIVCDYLDEVYPGKKLTPADPFQKAQQKMTLEHFS
KVTTVLYKIMGAKKNNEDLSTVKEELQEKLLKLDEILAKQNSLFFGGSEVSMVDYMIWPW
FERLIIFDAKDCLNKTTHIDKWYQQMLQDPAVKAIYIEPDVMLGFFKLYIQGDLEAYDYG
L
Download sequence
Identical sequences Q6NRQ9
NP_001084924.1.7800 gi|147900426|ref|NP_001084924| gi|47123008|gb|AAH70673|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]