SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147900512|ref|NP_001080305| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147900512|ref|NP_001080305|
Domain Number 1 Region: 162-269
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.05e-34
Family PDI-like 0.0048
Further Details:      
 
Domain Number 2 Region: 20-129
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.58e-33
Family PDI-like 0.003
Further Details:      
 
Domain Number 3 Region: 283-393
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000106
Family DsbC/DsbG C-terminal domain-like 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|147900512|ref|NP_001080305|
Sequence length 442
Comment protein disulfide isomerase-related protein [Xenopus laevis]
Sequence
MARAFLGAVACTLILAASAMYSPSDDVIELTLSNFNKEVIQSDSLWLVEFYAPWCGHCQR
LTPDWKKAATALKGVVKVGAVNADQHQSLGGQYGVRGFPTIKIFGANKNKPDDYQGGRTA
DAIIDAALNSLRSFVKDRLGGRSGGSDSGRQSYSGGSGGSKKDVIDLTDDTFDKNVLNSD
DVWLVEFYAPWCGHCKTLEPEWAAAATEVKEKTNGKVKLAAVDATVSQVLASRYGIRGFP
TIKIFQKGEEPVDYDGGRTKPDIVARAVDLFSENAPPPEINEILNGDIVKKTCEEHQLCI
VAVLPHILDTGAAGRNSYLEVMLKMADKYKKKMWGWLWAEAGTQMDLETSLGIGGFGYPA
MAAINARKMKFALLKGSFSEQGINEFLRELSYGRGSTSPVGGGAIPKINTVEPWDGKDGE
LPAEDDIDLSDVELDDIGKDEL
Download sequence
Identical sequences Q7ZWN2
gi|147900512|ref|NP_001080305| gi|28422183|gb|AAH46867| NP_001080305.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]